DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT1G51210

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_175532.1 Gene:AT1G51210 / 841544 AraportID:AT1G51210 Length:433 Species:Arabidopsis thaliana


Alignment Length:463 Identity:89/463 - (19%)
Similarity:149/463 - (32%) Gaps:151/463 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LVLFPHVNEGHFAVMRTLVTELANREHTIEV-------------YTGHGLGESLDNVTETVTAEF 79
            :::||:..:||...:..|..:|..|..|:.:             .:.|      .:....||..|
plant    21 IMVFPYPAQGHLLPLLDLTHQLCLRGLTVSIIVTPKNLPYLSPLLSAH------PSAVSVVTLPF 79

  Fly    80 PFWSELQKQAAPKG--NLADLG----LLPIEKLRQSLASVGARALDHFLAQEPIQKLLKMSYLEF 138
            |     .....|.|  |:.|||    .|.:..|||              .:|||...|       
plant    80 P-----HHPLIPSGVENVKDLGGYGNPLIMASLRQ--------------LREPIVNWL------- 118

  Fly   139 DFDVILVDYFYTEALLALGALHQRPVVGIISTDFGNYMDAVQEALVPA---------ACSPIDFE 194
                               :.|..|.|.:|| ||  ::...::..:|.         ..|.:.|.
plant   119 -------------------SSHPNPPVALIS-DF--FLGWTKDLGIPRFAFFSSGAFLASILHFV 161

  Fly   195 RDQPEMSFSVRLGNIRTCIA---RRKQFIKDHYGGQEQLVTKYFQLQSSIPELQASQ-------- 248
            .|:|.:..|..    ..|::   |...|..:|             |.|.||:...||        
plant   162 SDKPHLFESTE----PVCLSDLPRSPVFKTEH-------------LPSLIPQSPLSQDLESVKDS 209

  Fly   249 ------------LSVLLLNSHVPLITPKVSIQQIIPAGGLHIRG-PKE-----------LPWNVK 289
                        ....|...::..:..|||..::...|.|...| .||           |.|   
plant   210 TMNFSSYGCIFNTCECLEEDYMEYVKQKVSENRVFGVGPLSSVGLSKEDSVSNVDAKALLSW--- 271

  Fly   290 RFLEEARP--GAIYVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLP-----K 347
               .:..|  ..:|:..|:::.   |.||:.|.|...........:|........:|..     :
plant   272 ---LDGCPDDSVLYICFGSQKV---LTKEQCDDLALGLEKSMTRFVWVVKKDPIPDGFEDRVAGR 330

  Fly   348 NVMIQHAVPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAV-RLGVGL 411
            .::::...||:.:|:|..|..||.:....::.|.:.....||..|:...:..:..|.| .:||.:
plant   331 GMIVRGWAPQVAMLSHVAVGGFLIHCGWNSVLEAMASGTMILAWPMEADQFVDARLVVEHMGVAV 395

  Fly   412 QLEEGNVT 419
            .:.||..|
plant   396 SVCEGGKT 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 89/463 (19%)
UDPGT 25..514 CDD:278624 89/463 (19%)
AT1G51210NP_175532.1 Glycosyltransferase_GTB-type 18..432 CDD:385653 89/463 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.