DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT85A1

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_173656.1 Gene:UGT85A1 / 838846 AraportID:AT1G22400 Length:489 Species:Arabidopsis thaliana


Alignment Length:279 Identity:63/279 - (22%)
Similarity:110/279 - (39%) Gaps:80/279 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 QASQLSVLLLNSHVPLITPKV-SIQQIIP----AGGLHIRGPKELPWNVKRFLEEARPGAIYVQL 304
            :|.:.|.::||:...|....| ::|.|:|    .|.||:...:|        :||          
plant   224 RAKRASAIILNTFDDLEHDVVHAMQSILPPVYSVGPLHLLANRE--------IEE---------- 270

  Fly   305 GNE--QACGQLPKEKLDTLFAFFSARKQSIIW------TCHDVKTLE----GL------------ 345
            |:|  .....|.||:::.|....:..:.|:|:      |...||.|.    ||            
plant   271 GSEIGMMSSNLWKEEMECLDWLDTKTQNSVIYINFGSITVLSVKQLVEFAWGLAGSGKEFLWVIR 335

  Fly   346 PKNVMIQHAV-------------------PQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGL 391
            |..|..:.|:                   ||..:|:||.:..|||:....::.|.:...||::..
plant   336 PDLVAGEEAMVPPDFLMETKDRSMLASWCPQEKVLSHPAIGGFLTHCGWNSILESLSCGVPMVCW 400

  Fly   392 PLFQHEARNMELAV-RLGVGLQLEEGNVTTESLNWAVDRLLLESHFQLTIRDVSLEFRDRPLGAL 455
            |.|..:..|.:... ...||::: .|:|..|.:. ||.|.|::......:|:.::|::     .|
plant   401 PFFADQQMNCKFCCDEWDVGIEI-GGDVKREEVE-AVVRELMDGEKGKKMREKAVEWQ-----RL 458

  Fly   456 ASALFWVNYVARHKGGSAL 474
            |..      ...||.||::
plant   459 AEK------ATEHKLGSSV 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 63/279 (23%)
UDPGT 25..514 CDD:278624 63/279 (23%)
UGT85A1NP_173656.1 Glycosyltransferase_GTB_type 14..453 CDD:299143 56/248 (23%)
MGT 20..454 CDD:273616 56/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.