DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT76E2

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_200767.1 Gene:UGT76E2 / 836078 AraportID:AT5G59590 Length:449 Species:Arabidopsis thaliana


Alignment Length:458 Identity:93/458 - (20%)
Similarity:153/458 - (33%) Gaps:169/458 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LLALG-ALHQR--PVVGII--------STDFGNYMDAVQEALVPAACSPIDFERDQPEMSFSVRL 206
            ::.|| |||.:  .:..::        |.||.::    ....:|.:.:..|.:...|: .|.::|
plant    25 MMQLGKALHSKGFSITVVLTQSNRVSSSKDFSDF----HFLTIPGSLTESDLQNLGPQ-KFVLKL 84

  Fly   207 GNIRTCIARRKQ----------------FIKDHYGGQEQLVTKYFQLQSSI-------------- 241
            ..|  |.|..||                .:.|.|........|.|||.|.:              
plant    85 NQI--CEASFKQCIGQLLHEQCNNDIACVVYDEYMYFSHAAVKEFQLPSVVFSTTSATAFVCRSV 147

  Fly   242 ---------------PELQ-----------------------------------ASQLSVLLLNS 256
                           ||.|                                   ....|.:::||
plant   148 LSRVNAESFLIDMKDPETQDKVFPGLHPLRYKDLPTSVFGPIESTLKVYSETVNTRTASAVIINS 212

  Fly   257 HVPLITPKVS-IQQ-----IIPAGGLHI--RGPKELPWNVKRFLEEARP-----------GAIYV 302
            ...|.:..:: :||     :.|.|.|||  ..|..|       |||.|.           ..||:
plant   213 ASCLESSSLARLQQQLQVPVYPIGPLHITASAPSSL-------LEEDRSCVEWLNKQKSNSVIYI 270

  Fly   303 QLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCH-----DVKTLEGLPK--NVMIQHA------ 354
            .||:.....  .|:.|:..:. .|...|..:|...     ..:..|.||:  |.::...      
plant   271 SLGSLALMD--TKDMLEMAWG-LSNSNQPFLWVVRPGSIPGSEWTESLPEEFNRLVSERGYIVKW 332

  Fly   355 VPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHE---ARNMELAVRLGVGLQLEEG 416
            .||:::|.||.|..|.::....:..|.|...||::..|....:   ||.:|...|:||.|   ||
plant   333 APQMEVLRHPAVGGFWSHCGWNSTVESIGEGVPMICRPFTGDQKVNARYLERVWRIGVQL---EG 394

  Fly   417 NVTTESLNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIGI 481
            ::..|::..||:.||::        :...|.|.|.:.            .:.|..:::|:.|   
plant   395 DLDKETVERAVEWLLVD--------EEGAEMRKRAID------------LKEKIETSVRSGG--- 436

  Fly   482 SSC 484
            |||
plant   437 SSC 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 89/449 (20%)
UDPGT 25..514 CDD:278624 93/458 (20%)
UGT76E2NP_200767.1 Glycosyltransferase_GTB-type 1..449 CDD:415824 93/458 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.