DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT5G38040

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:486 Identity:108/486 - (22%)
Similarity:176/486 - (36%) Gaps:138/486 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHGLGESLDNVTETVTAEFPFWSELQKQAAPK 92
            :||.|...:||...|..|...|.::..:|.|                |..:|.:.:       |.
plant    11 VVLVPVPAQGHITPMIQLAKALHSKGFSITV----------------VQTKFNYLN-------PS 52

  Fly    93 GNLADLGLLPI-EKLRQS-LASVGARALDHFLAQEPIQKLLKMSYLEF-------------DFDV 142
            .:|:|...:.| |.|..| |.::|.   ..||.     ||....|:.|             :...
plant    53 NDLSDFQFVTIPENLPVSDLKNLGP---GRFLI-----KLANECYVSFKDLLGQLLVNEEEEIAC 109

  Fly   143 ILVDYFYTEALLALGALHQRPVV----------------------GIISTDFGNYMDAVQEALVP 185
            ::.|.|.....:|:.....|.|:                      |:.....|...:.   .|||
plant   110 VIYDEFMYFVEVAVKEFKLRNVILSTTSATAFVCRFVMCELYAKDGLAQLKEGGEREV---ELVP 171

  Fly   186 AACSPIDFERDQPEMSF-----SVRLGNIRTCIARRKQFIKDHYGGQEQLVTKYFQLQSSIPELQ 245
             ...||.: :|.|...|     ||.|.. .||           |.|....|     :.:::..|:
plant   172 -ELYPIRY-KDLPSSVFASVESSVELFK-NTC-----------YKGTASSV-----IINTVRCLE 217

  Fly   246 ASQLSVLLLNSHVPL--ITPKVSIQQIIPAGGLHIRGPKE--LPWNVKRFLEEARPGA-IYVQLG 305
            .|.|..|.....:|:  |.|   :..::.|....:....|  :.|     |.:.:|.: ||:.||
plant   218 MSSLEWLQQELEIPVYSIGP---LHMVVSAPPTSLLEENESCIEW-----LNKQKPSSVIYISLG 274

  Fly   306 NEQACGQLPKEKLDTLFAFFSARKQSIIWT------CHDVKTLEGLPKNVMIQHA------VPQI 358
            :...  ...||.|:..:.|.|: .|..:|.      |....:.|.|.|.::|...      .||.
plant   275 SFTL--METKEMLEMAYGFVSS-NQHFLWVIRPGSICGSEISEEELLKKMVITDRGYIVKWAPQK 336

  Fly   359 DILAHPRVKAFLT----NGDLLNLQEGIMRNVPILGLPLFQHE---ARNMELAVRLGVGLQLEEG 416
            .:|||..|.||.:    |..|.:|.||    ||::..|....:   ||.:|...::|:.:   ||
plant   337 QVLAHSAVGAFWSHCGWNSTLESLGEG----VPLICRPFTTDQKGNARYLECVWKVGIQV---EG 394

  Fly   417 NVTTESLNWAVDRLLL-ESHFQLTIRDVSLE 446
            .:...::..||.||:: |...::..|.:||:
plant   395 ELERGAIERAVKRLMVDEEGEEMKRRALSLK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 108/486 (22%)
UDPGT 25..514 CDD:278624 108/486 (22%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 108/486 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.