DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:389 Identity:82/389 - (21%)
Similarity:145/389 - (37%) Gaps:104/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GLGESLDNVTETVT-AEFPFWSELQKQAAPKGNLADLGLLPIEKLRQSLASVGARALDHFLAQEP 126
            |...||...:.||. .:|.:.:       |..:|||...:.|.   :||.:...:.|.      |
plant     5 GRAHSLKGFSITVAQTKFNYLN-------PSKDLADFQFITIP---ESLPASDLKTLG------P 53

  Fly   127 IQKLLKMS-YLEFDFDVILVDYFYTEALLALGALHQRPVVGIISTDFGNYMDAVQEALVPAACSP 190
            |..::|:: ..|..|...|..:...:         |..:..:|..:|..:.:|..:         
plant    54 IWFIIKLNKECEISFKKCLGQFLLQQ---------QEEIACVIYDEFMYFAEAAAK--------- 100

  Fly   191 IDFERDQPEMSFSVRLGNIRTC-IARRKQFIKDHY-------GGQEQLVTKYFQLQ------SSI 241
               |.:.|::.||........| .|..|.:.||..       |.:|:||.:...|:      |:.
plant   101 ---EFNLPKVIFSTENATAFACRSAMCKLYAKDGIAPLTEGCGREEELVPELHPLRYKDLPTSAF 162

  Fly   242 PELQAS-----------QLSVLLLNSHVPL-ITPKVSIQQ-----IIPAGGLHI---RGPKEL-- 284
            ..::||           ..|.:::|:...| |:....:||     |.|.|.|::   ..|..|  
plant   163 APVEASVEVFKSSCEKGTASSMIINTVSCLEISSLEWLQQELKIPIYPIGPLYMVSSAPPTSLLD 227

  Fly   285 ------PWNVKRFLEEARPGA-IYVQLGN----------EQACGQLPKEKLDTLFAFFSARKQSI 332
                  .|     |.:.:|.: ||:.||:          |.|.|.:...:    :..::.|..||
plant   228 ENESCIDW-----LNKQKPSSVIYISLGSFTLLETKEVLEMASGLVSSNQ----YFLWAIRPGSI 283

  Fly   333 I---WTCHDVKTLEGLPKNVMIQHAVPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPL 393
            :   .:..::.::..:|....|.....|..:|||..|.||.::....:..|.|...:||:||.|
plant   284 LGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGLLL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 82/389 (21%)
UDPGT 25..514 CDD:278624 82/389 (21%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 78/383 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.