DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:451 Identity:84/451 - (18%)
Similarity:158/451 - (35%) Gaps:161/451 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ANREHTIEVYTGHGLGESLDNVTETVTAEFPFWS------ELQKQAAPKGNLADLGLLPIEKLRQ 108
            |:|...|.||          ::.:.|...:.|..      ||..||||            |..|:
plant    62 ADRPANIRVY----------DIADGVPEGYVFSGRPQEAIELFLQAAP------------ENFRR 104

  Fly   109 SLA----SVGARALDHFLAQEPIQKLLKMSYLEFDFDVI-----------------LVDYFYTEA 152
            .:|    .||..          ::.|:..::..|..|:.                 |..:.||:.
plant   105 EIAKAETEVGTE----------VKCLMTDAFFWFAADMATEINASWIAFWTAGANSLSAHLYTDL 159

  Fly   153 L---LALGALHQR--PVVGIIS-------------TDFGNYMDAVQEAL-------VPAACSPI- 191
            :   :.:..:.:|  ..:|:||             ..||| :|:|...:       :|.|.:.. 
plant   160 IRETIGVKEVGERMEETIGVISGMEKIRVKDTPEGVVFGN-LDSVFSKMLHQMGLALPRATAVFI 223

  Fly   192 -DFERDQPEMSFSVR--------LGNIRTCIARRKQFIKDHYGGQEQLVTKYFQLQSSIPELQAS 247
             .||...|.::.::|        :|.:....:..:|.::|.:|     ...:.:.:||       
plant   224 NSFEDLDPTLTNNLRSRFKRYLNIGPLGLLSSTLQQLVQDPHG-----CLAWMEKRSS------- 276

  Fly   248 QLSVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKELP--WNVKRFLEEARPGAIYVQLGNEQAC 310
             .||..::....:..|...:..|  |.||.   ..::|  |::|                 |::.
plant   277 -GSVAYISFGTVMTPPPGELAAI--AEGLE---SSKVPFVWSLK-----------------EKSL 318

  Fly   311 GQLPKEKLDTLFAFFSARKQSII--WTCHDVKTLEGLPKNVMIQHAVPQIDILAHPRVKAFLTNG 373
            .||||..||      ..|:|.|:  |                    .||:::|.|.....|:|:.
plant   319 VQLPKGFLD------RTREQGIVVPW--------------------APQVELLKHEATGVFVTHC 357

  Fly   374 DLLNLQEGIMRNVPILGLPLFQHEARN-MELAVRLGVGLQLEEGNVTTESLNWAVDRLLLE 433
            ...::.|.:...||::..|.|..:..| ..:.|...:|:.:..|..|.:.....:|::|::
plant   358 GWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCLDKVLVQ 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 84/451 (19%)
UDPGT 25..514 CDD:278624 84/451 (19%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 84/451 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.