DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:360 Identity:76/360 - (21%)
Similarity:140/360 - (38%) Gaps:71/360 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ALDHFL--AQEPIQKLLKMSYLEF--DFDVILVDYFYTEALLALGALHQRPVV-----GIISTDF 172
            |::.||  |.|..::.:|.:..|.  .|..||.|.|...|.....|..:...|     |..|...
plant    86 AVELFLEAAPEIFRREIKAAETEVGRKFKCILTDAFLWLAAETAAAEMKASWVAYYGGGATSLTA 150

  Fly   173 GNYMDAVQEALVPAACSPIDFERDQPEMSFSVRLGNIRTCIARRKQFIKDH-----YGGQEQLVT 232
            ..|.||::|.:......    ||.:..:.|...:..||         :||.     :|..:.:.:
plant   151 HLYTDAIRENVGVKEVG----ERMEETIGFISGMEKIR---------VKDTQEGVVFGNLDSVFS 202

  Fly   233 K-YFQLQSSIPELQASQLSVLLLNSHV---PLITP--KVSIQQIIPAGGLH-IRGPKE------- 283
            | ..|:..::|...|     :.:||..   |..|.  :...::.:..|.|. :..|.:       
plant   203 KTLHQMGLALPRATA-----VFINSFEELDPTFTNDFRSEFKRYLNIGPLALLSSPSQTSTLVHD 262

  Fly   284 ----LPWNVKRFLEEARPGAIYVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEG 344
                |.|..||    :.....|:..|.   ....|..:|..:.....:.|...:|:..::| :..
plant   263 PHGCLAWIEKR----STASVAYIAFGR---VATPPPVELVAIAQGLESSKVPFVWSLQEMK-MTH 319

  Fly   345 LPKNV--------MIQHAVPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLF-QH--EA 398
            ||:..        |:....||:::|.|..:..|:::|...::.|.:...||::..|:| .|  .|
plant   320 LPEGFLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINA 384

  Fly   399 RNMELAVRLGVGLQLEEGNVTTESLNWAVDRLLLE 433
            |::|....:||  .:..|..|.:....::||:|::
plant   385 RSVEAVWEIGV--TISSGVFTKDGFEESLDRVLVQ 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 76/360 (21%)
UDPGT 25..514 CDD:278624 76/360 (21%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 76/360 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.