DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT5G05900

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_196209.1 Gene:AT5G05900 / 830475 AraportID:AT5G05900 Length:450 Species:Arabidopsis thaliana


Alignment Length:266 Identity:58/266 - (21%)
Similarity:102/266 - (38%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 SSIPELQASQLSVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKE--LPWNVKRFLEEARPGAIY 301
            |:..||....||....:..||:.|...| ....|.....:....|  :||..|    :.....||
plant   215 STCEELDQDSLSQAREDYQVPIFTIGPS-HSYFPGSSSSLFTVDETCIPWLDK----QEDKSVIY 274

  Fly   302 VQLGNEQACGQLPKEKLDTLFAFFSARKQSIIW------TCHDVKTLEGLPKNVMIQHAVPQIDI 360
            |..|:....|:  .|.::..:|..:: .|..:|      ..|..:.:|.|.:...|.:..||.::
plant   275 VSFGSISTIGE--AEFMEIAWALRNS-DQPFLWVVRGGSVVHGAEWIEQLHEKGKIVNWAPQQEV 336

  Fly   361 LAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAVRLG-VGLQLEEGNVTTESLN 424
            |.|..:..|||:....:..|.:...||::.:|....:..|......:. |||.| ||.:....:.
plant   337 LKHQAIGGFLTHNGWNSTVESVFEGVPMICMPFVWDQLLNARFVSDVWMVGLHL-EGRIERNVIE 400

  Fly   425 WAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIGISSCQLHLF 489
            ..:.||..|:..: .||: .:|                  :.:...|.:::.:|....|.| ||.
plant   401 GMIRRLFSETEGK-AIRE-RME------------------ILKENVGRSVKPKGSAYRSLQ-HLI 444

  Fly   490 DLFVFY 495
            |...::
plant   445 DYITYF 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 52/246 (21%)
UDPGT 25..514 CDD:278624 58/266 (22%)
AT5G05900NP_196209.1 Glycosyltransferase_GTB_type 2..447 CDD:299143 58/261 (22%)
YjiC 8..436 CDD:224732 53/249 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.