DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT76C2

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:168 Identity:45/168 - (26%)
Similarity:66/168 - (39%) Gaps:41/168 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 IYVQLGN----------EQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTL---------EGL 345
            |||.||:          |.|||             .|..||..:|.......|         |||
plant   266 IYVSLGSVVNITETEFLEIACG-------------LSNSKQPFLWVVRPGSVLGAKWIEPLSEGL 317

  Fly   346 -----PKNVMIQHAVPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAV 405
                 .|..:::.| ||.::|||.....|||:....:..|.|...||::.||....:..|.....
plant   318 VSSLEEKGKIVKWA-PQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQMLNSRFVS 381

  Fly   406 RL-GVGLQLEEGNVTTESLNWAVDRLLLESHFQLTIRD 442
            .: .:|:.| ||.:..:.:..|| |:|:|......||:
plant   382 DIWKIGIHL-EGRIEKKEIEKAV-RVLMEESEGNKIRE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 45/168 (27%)
UDPGT 25..514 CDD:278624 45/168 (27%)
UGT76C2NP_196205.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 45/168 (27%)
YjiC 9..429 CDD:224732 45/168 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.