DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT3G46680

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_190252.1 Gene:AT3G46680 / 823821 AraportID:AT3G46680 Length:449 Species:Arabidopsis thaliana


Alignment Length:487 Identity:99/487 - (20%)
Similarity:175/487 - (35%) Gaps:132/487 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KILVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHGLGESLDNVTETVTAEFP---FWSELQK 87
            |.:||.|...:.|...|..|.|.|..:..:|.|..|     ..:.|:.  :..||   |.:....
plant     8 KRIVLVPVPAQRHVTPMMQLGTALNMKGFSITVVEG-----QFNKVSS--SQNFPGFQFVTIPDT 65

  Fly    88 QAAPKGNLADLGLLPIEKL----RQSLASVGARALDHFLAQEPIQKLLKMSYLEFDFDVILVDYF 148
            ::.|:..|..||  |:|.|    :.|.||              .:..::.|.|:...|:..:  .
plant    66 ESLPESVLERLG--PVEFLFEINKTSEAS--------------FKDCIRQSLLQQGNDIACI--I 112

  Fly   149 YTEALLALGALHQRPVVGIISTDFGNYMDAVQEALVPAACSPIDFERDQPEMSFSVR--LGNIRT 211
            |.|.:...||..:                                |.:.|.:.||.:  ...:..
plant   113 YDEYMYFCGAAAK--------------------------------EFNLPSVIFSTQSATNQVSR 145

  Fly   212 CIARR---KQFIKDHYGG--QEQLV-------------------TKYFQLQSSIPELQASQLSVL 252
            |:.|:   ::|:.|....  ||.||                   .:.|:|...|...:.:...::
plant   146 CVLRKLSAEKFLVDMEDPEVQETLVENLHPLRYKDLPTSGVGPLDRLFELCREIVNKRTASAVII 210

  Fly   253 -----LLNSHVPLITPKVSIQQIIPAGGLHI-----RGPKELPWNVKRFLEEARP-GAIYVQLGN 306
                 |.:|.:..:..::.| .:...|.|||     ....|...:...:|.:.:| ..:|:.||:
plant   211 NTVRCLESSSLKRLQHELGI-PVYALGPLHITVSAASSLLEEDRSCVEWLNKQKPRSVVYISLGS 274

  Fly   307 EQACGQLPKEKLDTLFAFFSARKQSIIWTCH-----DVKTLEGLPKNVM--------IQHAVPQI 358
              ......||.|:.....|:: .|..:|...     ..:.:|.||:.|:        |....|||
plant   275 --VVQMETKEVLEMARGLFNS-NQPFLWVIRPGSIAGSEWIESLPEEVIKMVSERGYIVKWAPQI 336

  Fly   359 DILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARN---MELAVRLGVGLQLEEGNVTT 420
            ::|.||.|..|.::....:..|.|:..||::..|....:..|   :|...|:|..:|   |.|..
plant   337 EVLGHPAVGGFWSHCGWNSTLESIVEGVPMICRPFHGEQKLNALCLESIWRIGFQVQ---GKVER 398

  Fly   421 ESLNWAVDRLLLESHFQLTIRDVSLEFRDRPL 452
            ..:..||.||:::        :...:.|:|.|
plant   399 GGVERAVKRLIVD--------EEGADMRERAL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 99/487 (20%)
UDPGT 25..514 CDD:278624 99/487 (20%)
AT3G46680NP_190252.1 Glycosyltransferase_GTB_type 1..449 CDD:299143 99/487 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.