DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT76E11

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_190251.1 Gene:UGT76E11 / 823820 AraportID:AT3G46670 Length:451 Species:Arabidopsis thaliana


Alignment Length:485 Identity:97/485 - (20%)
Similarity:180/485 - (37%) Gaps:136/485 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILVLFPHVNEGHFAVMRTLVTELANREHTIEV-YTGHGLGESLDNVTETVTAEFPFWSELQKQAA 90
            :||..|  .:||.:.:..|...|..:..:|.: .|........|:.|:......|       ::.
plant    11 VLVAVP--AQGHISPIMQLAKTLHLKGFSITIAQTKFNYFSPSDDFTDFQFVTIP-------ESL 66

  Fly    91 PKGNLADLGLLPIEKLRQSLASVGARALDHFLAQEPIQKLLKMSYLEFDFDVILVDYFYTEALLA 155
            |:.:..|||  |||.|.:                  :.|..::|:.:                 .
plant    67 PESDFEDLG--PIEFLHK------------------LNKECQVSFKD-----------------C 94

  Fly   156 LGAL---HQRPVVGIISTDFGNYMDAVQEALVPAACSPIDFERDQPEMSFSVRLGNIRTCIARRK 217
            ||.|   ....:..::..:|..:.:|..:            |...|.:.||........|   |.
plant    95 LGQLLLQQGNEIACVVYDEFMYFAEAAAK------------EFKLPNVIFSTTSATAFVC---RS 144

  Fly   218 QF-----------IKDHYGGQEQLVTKYFQLQ------------SSIPELQASQL-----SVLLL 254
            .|           :|:..|.|.:||.::..|:            .|:.||..:.:     |.:::
plant   145 AFDKLYANSILTPLKEPKGQQNELVPEFHPLRCKDFPVSHWASLESMMELYRNTVDKRTASSVII 209

  Fly   255 NSHVPLITPKVS-IQQ-----IIPAGGLHI----------RGPKELPWNVKRFLEEARPGAIYVQ 303
            |:...|.:..:| :||     :.|.|.||:          .....:.|..|    :.:...|:|.
plant   210 NTASCLESSSLSRLQQQLQIPVYPIGPLHLVASASTSLLEENKSCIEWLNK----QKKNSVIFVS 270

  Fly   304 LGNEQACGQLPKEKLDTLFAFFSARKQSIIW-----TCHDVKTLEGLPKNV--------MIQHAV 355
            ||: .|..:: .|.::|.....|: ||..:|     :....:.:|.|||..        .|....
plant   271 LGS-LALMEI-NEVIETALGLDSS-KQQFLWVIRPGSVRGSEWIENLPKEFSKIISGRGYIVKWA 332

  Fly   356 PQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHE---ARNMELAVRLGVGLQLEEGN 417
            ||.::|:||.|..|.::....:..|.|...||::..|....:   ||.:|...::|:.:   ||:
plant   333 PQKEVLSHPAVGGFWSHCGWNSTLESIGEGVPMICKPFSSDQMVNARYLECVWKIGIQV---EGD 394

  Fly   418 VTTESLNWAVDRLLLESHFQ-LTIRDVSLE 446
            :...::..||.||::|...: :..|.:||:
plant   395 LDRGAVERAVRRLMVEEEGEGMRKRAISLK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 97/485 (20%)
UDPGT 25..514 CDD:278624 97/485 (20%)
UGT76E11NP_190251.1 PLN02410 1..451 CDD:178032 97/485 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.