DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT76B1

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_187742.1 Gene:UGT76B1 / 820307 AraportID:AT3G11340 Length:447 Species:Arabidopsis thaliana


Alignment Length:447 Identity:91/447 - (20%)
Similarity:160/447 - (35%) Gaps:96/447 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHGLGESLDNVTETVTAEFPFWSELQKQAAP 91
            ::.|||...:||...|..|.....||..:|.|     :....::...:....|.|.|.....:.|
plant     9 VIFLFPFPLQGHLNPMFQLANIFFNRGFSITV-----IHTEFNSPNSSNFPHFTFVSIPDSLSEP 68

  Fly    92 KGNLADLGLLPIEKLRQSLASVGARALDHFLAQEPIQKLLKMSYL---------EFDFDVILVDY 147
            :.....:.:|  ..|.....:.....|...:::||....:.:..|         :|:|..|::..
plant    69 ESYPDVIEIL--HDLNSKCVAPFGDCLKKLISEEPTAACVIVDALWYFTHDLTEKFNFPRIVLRT 131

  Fly   148 FYTEALLALGALHQRPVVGIISTDFGNYMDAVQEALVPAACSPID------------FERDQPEM 200
            ....|.:|....|.....|.:|         :||.   .|.||:.            |:.:.|..
plant   132 VNLSAFVAFSKFHVLREKGYLS---------LQET---KADSPVPELPYLRMKDLPWFQTEDPRS 184

  Fly   201 SFSVRLGNIRTCIARRKQFIKDHYGGQEQLVTKYFQLQSSIPELQASQLSVLLLNSHVPL--ITP 263
            ...:::|.:::        :|...|          .:.::|.:|:..||....:...|||  |.|
plant   185 GDKLQIGVMKS--------LKSSSG----------IIFNAIEDLETDQLDEARIEFPVPLFCIGP 231

  Fly   264 KVSIQQIIPA--GGLHIRGPKELPWNVKRFLEEARPGAIYVQLGNEQACGQLPKEKLDTLFAFFS 326
               ..:.:.|  ..|.......|.|..|    :|....||..||:..:..:  .|.|:..:...:
plant   232 ---FHRYVSASSSSLLAHDMTCLSWLDK----QATNSVIYASLGSIASIDE--SEFLEIAWGLRN 287

  Fly   327 ARKQSIIWT-----CHDVKTLEGLPKNVM--------IQHAVPQIDILAHPRVKAFLTNGDLLNL 378
            : .|..:|.     .|..:.:|.|||..:        |....||.::|||.....|||:....:.
plant   288 S-NQPFLWVVRPGLIHGKEWIEILPKGFIENLEGRGKIVKWAPQPEVLAHRATGGFLTHCGWNST 351

  Fly   379 QEGIMRNVPILGLPLFQHEARNMELAVRL-GVGLQLEEGNVTTESLNWAVDRLLLES 434
            .|||...:|::..|.|..:..|......: .:||.||.          .|:||::|:
plant   352 LEGICEAIPMICRPSFGDQRVNARYINDVWKIGLHLEN----------KVERLVIEN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 91/447 (20%)
UDPGT 25..514 CDD:278624 91/447 (20%)
UGT76B1NP_187742.1 Glycosyltransferase_GTB-type 1..444 CDD:415824 91/447 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.