Sequence 1: | NP_001286734.1 | Gene: | Ugt317A1 / 37590 | FlyBaseID: | FBgn0040091 | Length: | 529 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_186859.1 | Gene: | AT3G02100 / 820287 | AraportID: | AT3G02100 | Length: | 464 | Species: | Arabidopsis thaliana |
Alignment Length: | 271 | Identity: | 55/271 - (20%) |
---|---|---|---|
Similarity: | 101/271 - (37%) | Gaps: | 66/271 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 VTKYFQLQSSIPELQA------------SQLSV----------------LLLNSHVPLITPKVSI 267
Fly 268 -QQIIPAG---------------GLHIRGPKE-LPWNVKRFLEEARPGA-IYVQLGNEQACGQLP 314
Fly 315 KEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQHAVPQIDILAHPRVKAFLTNGDLLNLQ 379
Fly 380 EGIMRNVPILGLPLFQHEARNMELAV---RLGVGLQLEEGNVTTESLNWAVDRLLLESHFQLTIR 441
Fly 442 DVSLEFRDRPL 452 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ugt317A1 | NP_001286734.1 | Glycosyltransferase_GTB_type | 22..477 | CDD:299143 | 55/271 (20%) |
UDPGT | 25..514 | CDD:278624 | 55/271 (20%) | ||
AT3G02100 | NP_186859.1 | Glycosyltransferase_GTB_type | 7..444 | CDD:299143 | 55/271 (20%) |
YjiC | 11..437 | CDD:224732 | 55/271 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 89 | 1.000 | Inparanoid score | I2281 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR48043 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.150 |