DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT3G02100

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_186859.1 Gene:AT3G02100 / 820287 AraportID:AT3G02100 Length:464 Species:Arabidopsis thaliana


Alignment Length:271 Identity:55/271 - (20%)
Similarity:101/271 - (37%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 VTKYFQLQSSIPELQA------------SQLSV----------------LLLNSHVPLITPKVSI 267
            |.|..||...:|:::.            ||.::                ||.||...|.|....:
plant   179 VNKTIQLSPGMPKMETDKFVWVCLKNKESQKNIFQLMLQNNNSIESTDWLLCNSVHELETAAFGL 243

  Fly   268 -QQIIPAG---------------GLHIRGPKE-LPWNVKRFLEEARPGA-IYVQLGNEQACGQLP 314
             ..|:|.|               |..:...:: |.|     |:...||: |||..|   :.|.:.
plant   244 GPNIVPIGPIGWAHSLEEGSTSLGSFLPHDRDCLDW-----LDRQIPGSVIYVAFG---SFGVMG 300

  Fly   315 KEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQHAVPQIDILAHPRVKAFLTNGDLLNLQ 379
            ..:|:.|.......|:.::|...|.:.::.....|.:....||.::|:...:..|:::....:..
plant   301 NPQLEELAIGLELTKRPVLWVTGDQQPIKLGSDRVKVVRWAPQREVLSSGAIGCFVSHCGWNSTL 365

  Fly   380 EGIMRNVPILGLPLFQHEARNMELAV---RLGVGLQLEEGNVTTESLNWAVDRLLLESHFQLTIR 441
            ||....:|.|.:|.|..:..|.....   ::|:||:.:...|        |.||.::......:|
plant   366 EGAQNGIPFLCIPYFADQFINKAYICDVWKIGLGLERDARGV--------VPRLEVKKKIDEIMR 422

  Fly   442 DVSLEFRDRPL 452
            |.. |:.:|.:
plant   423 DGG-EYEERAM 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 55/271 (20%)
UDPGT 25..514 CDD:278624 55/271 (20%)
AT3G02100NP_186859.1 Glycosyltransferase_GTB_type 7..444 CDD:299143 55/271 (20%)
YjiC 11..437 CDD:224732 55/271 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48043
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.