DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT2G30150

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001323694.1 Gene:AT2G30150 / 817567 AraportID:AT2G30150 Length:456 Species:Arabidopsis thaliana


Alignment Length:485 Identity:102/485 - (21%)
Similarity:177/485 - (36%) Gaps:96/485 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHGLGESLDNVTETVTAEFPFW-----SELQK 87
            :|..|....||...|..|...|..|:..:             .||..||.|   |     |:   
plant    14 VVAMPWPGRGHINPMLNLCKSLVRRDPNL-------------TVTFVVTEE---WLGFIGSD--- 59

  Fly    88 QAAPKGNLADLGLLPIEKLRQSLASVGARALDHFLA---------QEPIQKLLKMSYLEFDFDVI 143
               ||.|......||     ..:.|...||.| |:|         :||.::||  ..|......|
plant    60 ---PKPNRIHFATLP-----NIIPSELVRAND-FIAFIDAVLTRLEEPFEQLL--DRLNSPPTAI 113

  Fly   144 LVDYFYTEALLALGALHQRPVVGIISTDFGNYMDAVQEALVPA----ACSPIDFERDQ-----PE 199
            :.|.:...| :.:|.....||....:|........:...|:.:    ...|.:.:.|:     |.
plant   114 IADTYIIWA-VRVGTKRNIPVASFWTTSATILSLFINSDLLASHGHFPIEPSESKLDEIVDYIPG 177

  Fly   200 MSFSVRLGNIRTCIARRKQ---FIKDHYGGQEQLVTKYFQLQSSIPELQASQLSVLLLNSHVPLI 261
            :| ..||.:::.......|   ..|..:|  |....||....|:. ||:...:.........|: 
plant   178 LS-PTRLSDLQILHGYSHQVFNIFKKSFG--ELYKAKYLLFPSAY-ELEPKAIDFFTSKFDFPV- 237

  Fly   262 TPKVSIQQIIPAGGLHIRGP-KELPWNVKRFLEEARPGAIYVQLGNEQACGQLPKEKLDTLFAFF 325
               .|...:||...|.:... :||.: .|...|:.....:|:..|:..:..:...|::     ..
plant   238 ---YSTGPLIPLEELSVGNENRELDY-FKWLDEQPESSVLYISQGSFLSVSEAQMEEI-----VV 293

  Fly   326 SARKQSI--IWTCH--DVKTLEGLPKNV-MIQHAVPQIDILAHPRVKAFLTNGDLLNLQEGIMRN 385
            ..|:..:  .|...  ::|..|.|..:: ::.....|:.:|.|..:..|.|:....:..|||...
plant   294 GVREAGVKFFWVARGGELKLKEALEGSLGVVVSWCDQLRVLCHAAIGGFWTHCGYNSTLEGICSG 358

  Fly   386 VPILGLPLFQHEARNMELAV---RLGVGLQLE---EGNVTTESLNWAVDRLL-LESHFQLTIRDV 443
            ||:|..|:|..:..|.::.|   |:|:|::.:   |..:.::.:...|.|.: .||.....:|..
plant   359 VPLLTFPVFWDQFLNAKMIVEEWRVGMGIERKKQMELLIVSDEIKELVKRFMDGESEEGKEMRRR 423

  Fly   444 SLEFRDRPLGALASALFWVNYVARHKGGSA 473
            :.:..:...||:|            ||||:
plant   424 TCDLSEICRGAVA------------KGGSS 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 102/485 (21%)
UDPGT 25..514 CDD:278624 102/485 (21%)
AT2G30150NP_001323694.1 PLN02448 11..456 CDD:215247 102/485 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.