DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT73B5

DIOPT Version :10

Sequence 1:NP_611694.2 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:76 Identity:18/76 - (23%)
Similarity:34/76 - (44%) Gaps:16/76 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 HQSLPNTIEEAQKFGKNQRFWS--LPKAPQVTREADS---NTDKRHDGSDAKPEES------IRL 575
            |...|::...::|  |...|:.  ..:..|:.:|:||   :|.|...|.:...:|:      |:.
plant   216 HIYRPSSFRGSKK--KKDCFYDKVTDEIEQIVKESDSLAAHTRKESFGDELTSKEAEDPDVLIKT 278

  Fly   576 TVPV---EGEE 583
            .|.:   ||:|
plant   279 IVSILRKEGDE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_611694.2 GT1_Gtf-like 25..431 CDD:340817
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.