DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and ugt2a6

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001138283.1 Gene:ugt2a6 / 797211 ZFINID:ZDB-GENE-081104-3 Length:529 Species:Danio rerio


Alignment Length:540 Identity:126/540 - (23%)
Similarity:214/540 - (39%) Gaps:81/540 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLAILGLALGQISQAAKILVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHGLGESLDNVTET 74
            ||..|.|....:..:.::||:....:  |:..||.::..|.::.|::.|.    :|.|...|..|
Zfish     6 LLVCLLLCGVDVGWSGRVLVMPGEYS--HWHNMRPVIEALVDKNHSVTVL----VGSSSPTVPHT 64

  Fly    75 VTAEFPF---------------WSELQ-----------KQAAPKGNLADLGLLPIEKLRQSLASV 113
            ....|.:               |....           ::......|..|.....|:|.:.|..|
Zfish    65 QKERFEYHVFKVNMEKEVVDYLWIHFHELWMNETISTYEKTLEVWQLMSLFRAHSEELVKGLFDV 129

  Fly   114 GARALDHFLAQEPIQKLLKMSYLEFDFDVILVDYFYTEALLALGALHQRPVVGIISTDFGNYMD- 177
            |               ||| :..:.::||:..|.....:.|....|: .|.|..:...|.:.:: 
Zfish   130 G---------------LLK-TLRDSNYDVLFSDLTMPFSDLMAQKLN-IPHVLSMRISFASALER 177

  Fly   178 -----AVQEALVPAACSPIDFERDQPEMSFSVRLGNIRTCIARRKQFIKDHYGGQEQLVTKYFQL 237
                 .|.::.||||.:....   ...|||:.|:.|:...|.....|         ||.|| |..
Zfish   178 LCGQMPVPQSYVPAAVAQGHL---TDRMSFTERVENMLLYITHTAMF---------QLTTK-FTF 229

  Fly   238 QSSIPELQA---------SQLSVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKELPWNVKRFLE 293
            .....|:..         .:..:.|:.::.....|:.........|||..:..|.|...::.|::
Zfish   230 DHIYAEISGEPTTMCETIGKTDIWLIRTYWDFEYPRPFPPNFKFVGGLQCKPAKPLAKELEEFVQ 294

  Fly   294 EARP-GAIYVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQHAVPQ 357
            .:.. |.:...||:  ....|..:|.:|:.|......|.::|. :..||.|.|..|..|...:||
Zfish   295 SSGDHGIVVFSLGS--MIKNLTVQKANTIAAALGQISQKVVWR-YSGKTPETLAPNTKIYDWIPQ 356

  Fly   358 IDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAVRLGVGLQLEEGNVTTES 422
            .|:|.||:.|||:|:|....|.|.|...||::|||||..:..|:......|..:.|:...:.::.
Zfish   357 NDLLGHPKTKAFITHGGTNGLYEAIYHGVPMVGLPLFGDQPDNLMHLKSKGAAVVLDFFTLESKD 421

  Fly   423 LNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIGISSCQLH 487
            |..|:..:|....::.:|..:|....|:|:..|..|::|:.:|.|:||...||.:...:|..|.|
Zfish   422 LVDALKTVLNNPSYKESIMRLSRIHHDQPMKPLDQAVYWIEFVMRNKGAKHLRVQAHELSWYQYH 486

  Fly   488 LFDLFVFYAGIATLVVSLLV 507
            ..|:..|...|..|:..|.|
Zfish   487 CLDVAAFLLSITALITFLWV 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 113/496 (23%)
UDPGT 25..514 CDD:278624 122/525 (23%)
ugt2a6NP_001138283.1 UDPGT 21..519 CDD:278624 122/525 (23%)
egt <254..485 CDD:223071 64/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.