DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT8

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001121646.2 Gene:UGT8 / 7368 HGNCID:12555 Length:541 Species:Homo sapiens


Alignment Length:567 Identity:139/567 - (24%)
Similarity:231/567 - (40%) Gaps:119/567 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILGLALGQISQAAKILVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHGLGESLD-------- 69
            :|..|:| |::||||:::.|.:.|.|..:.:||.:.|..|.|    :|...|.|..|        
Human    10 LLWSAVG-IAKAAKIIIVPPIMFESHMYIFKTLASALHERGH----HTVFLLSEGRDIAPSNHYS 69

  Fly    70 -----NVTETVTAEFPFWSELQKQAAPKGNLADLGLLPIEKLRQSLASVGARALDHFLA------ 123
                 .:..:.|::....|:::...:  |.|..:.|..|              |||:..      
Human    70 LQRYPGIFNSTTSDAFLQSKMRNIFS--GRLTAIELFDI--------------LDHYTKNCDLMV 118

  Fly   124 --QEPIQKLLKMSYLEFDFDVILVD-----YFYTEALLALGALHQRPVVGIISTDFGNYMDAVQE 181
              ...||.|.|..     ||::|||     .|....||.:       ...:.||  |.:..|...
Human   119 GNHALIQGLKKEK-----FDLLLVDPNDMCGFVIAHLLGV-------KYAVFST--GLWYPAEVG 169

  Fly   182 ALVPAACSPIDFERDQPEMSFSVRLGNIRTCIARRKQ---FIKDHYGGQEQLVTKY---FQLQSS 240
            |..|.|..|          .|:..|.:....:.|.|.   ::....|....::.||   .|..:.
Human   170 APAPLAYVP----------EFNSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNL 224

  Fly   241 IPELQASQL----SVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKELPWNVKRFLEEARP-GAI 300
            :||.....|    |:.:|.:.|.|..|:.::..::..||:..:....||.:::|::..|.. |.:
Human   225 LPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFV 289

  Fly   301 YVQLG------NEQ-------ACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQ 352
            .|..|      :|.       |.|:||               |.:||.....|. :.|..|..:.
Human   290 LVSFGAGVKYLSEDIANKLAGALGRLP---------------QKVIWRFSGPKP-KNLGNNTKLI 338

  Fly   353 HAVPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAVRLGVGLQLEEGN 417
            ..:||.|:|.|.::||||::|.|.::.|.|...||::|:|||......|......|:|:.||...
Human   339 EWLPQNDLLGHSKIKAFLSHGGLNSIFETIYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKT 403

  Fly   418 VTTESLNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIGIS 482
            ||.:.|..|:.:::....::...:.:|...:|:|...:...::|::|:.||.|...||.....||
Human   404 VTEKELYEALVKVINNPSYRQRAQKLSEIHKDQPGHPVNRTIYWIDYIIRHNGAHHLRAAVHQIS 468

  Fly   483 SCQLHLFDL-FVFYAGIATLVVSLLVALSFGGFY-----IWNKKNNS 523
            .||..|.|: ||...|.|.|...|.....|  .|     :|::..:|
Human   469 FCQYFLLDIAFVLLLGAALLYFLLSWVTKF--IYRKIKSLWSRNKHS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 119/504 (24%)
UDPGT 25..514 CDD:278624 131/539 (24%)
UGT8NP_001121646.2 Glycosyltransferase_GTB-type 21..502 CDD:415824 132/542 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.