DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and UGT2B17

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001068.1 Gene:UGT2B17 / 7367 HGNCID:12547 Length:530 Species:Homo sapiens


Alignment Length:540 Identity:118/540 - (21%)
Similarity:216/540 - (40%) Gaps:72/540 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESQWNRWILLAILGLALGQISQAAKILVLFPHVNEGHFAVMRTLVTELANREHTIEVYTGHGLG 65
            |..:|....||..|...... ....|:|| :| ....|:..|:|::.||..|.|.:.|.|..  .
Human     1 MSLKWMSVFLLMQLSCYFSS-GSCGKVLV-WP-TEYSHWINMKTILEELVQRGHEVIVLTSS--A 60

  Fly    66 ESLDNVTETVTAEFPFWSELQKQAAPKGNLADLGLLPIEKLRQSLASVGARALDHFLAQ------ 124
            ..|.|.:::...:.    |:...:..|.:|.|..:...::...|::.   .....:.:|      
Human    61 SILVNASKSSAIKL----EVYPTSLTKNDLEDFFMKMFDRWTYSISK---NTFWSYFSQLQELCW 118

  Fly   125 ------------EPIQKLLKMSYLEFDFDVILVDYF-----YTEALLALGALHQ-RPVVG-IIST 170
                        ..:.|.|.....|..|||:|.|..     ....||.:..|:. |..|| .:..
Human   119 EYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEK 183

  Fly   171 DFGNYMDAVQEALVPAACSPIDFERDQPEMSFSVRLGNI-----------RTCIARRKQFIKDHY 224
            :.|.:       |.|.:..|:.......:|.|..|:.|:           ...:.:..||..:..
Human   184 NGGGF-------LFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVL 241

  Fly   225 GGQEQLVTKYFQLQSSIPELQASQLSVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKELPWNVK 289
            |..    |..|:..        .:..:.|:.::.....|:..:..:...||||.:..|.||..::
Human   242 GRP----TTLFETM--------GKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEME 294

  Fly   290 RFLEEA-RPGAIYVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQH 353
            .|::.: ..|.:...||:  ....:.:|..:.:.:..:...|.::|. .|.|....|..|..:..
Human   295 EFVQSSGENGIVVFSLGS--MISNMSEESANMIASALAQIPQKVLWR-FDGKKPNTLGSNTRLYK 356

  Fly   354 AVPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAVRLGVGLQLEEGNV 418
            .:||.|:|.||:.|||:|:|....:.|.|...:|::|:|||..:..|:......|..|.::...:
Human   357 WLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTM 421

  Fly   419 TTESLNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIGISS 483
            ::..|..|:..::.:..::..|..:|....|:|:..|..|:||:.:|.||||...||.....::.
Human   422 SSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTW 486

  Fly   484 CQLHLFDLFVF-YAGIATLV 502
            .|.|..|:..| .|.:||::
Human   487 IQYHSLDVIAFLLACVATMI 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 106/491 (22%)
UDPGT 25..514 CDD:278624 113/516 (22%)
UGT2B17NP_001068.1 UDPGT 24..518 CDD:278624 113/516 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.