DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:424 Identity:99/424 - (23%)
Similarity:180/424 - (42%) Gaps:75/424 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DHFLAQEPIQKLLKMSYLEFDFDVIL---VDYFYTEALLALGALHQRPVVGIISTDFGNYMDAVQ 180
            :|.|:::.|.:.||.:    :||::|   |||..:..:..||    :..|..::...| :|| .:
  Rat    52 NHLLSRKDIMEFLKNA----NFDLVLFESVDYCSSLIVEKLG----KQFVLFLAFQLG-FMD-FE 106

  Fly   181 EALVPAACSPIDFERDQPEMSFSVRLGNIRTC--IARRKQFIKDHYGGQEQLVTKYFQLQSSIPE 243
            ...||.:..|:.......:|.|..|:.|....  ::|:::.|...|..         .:|....|
  Rat   107 LQRVPLSYVPVYGSGLTDQMDFWGRVKNFLMFFDLSRKQREILSQYDS---------TIQEHFAE 162

  Fly   244 LQASQLSVLLLNSHVPLITPKVSIQ-------QIIPAGGLHIRGPKELPWNVKRFLEE-ARPGAI 300
            .....||.|||.:.:..:....:.:       .|:..|||..:..:.:|.:::.|:.: ...|.:
  Rat   163 GSRPVLSDLLLKAELWFVNCDFAFEFARPLFPNIVYVGGLLDKPVQSIPQDLENFITQFGDSGFV 227

  Fly   301 YVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPK------NVMIQHAVPQID 359
            .|.||......| .||.:..:...|:...|.:||.|.|    ...||      ||.|...:||.|
  Rat   228 LVALGTVATKFQ-TKEIIKEMNNAFAHLPQGVIWACKD----SHWPKDVTLAPNVKIMDWLPQTD 287

  Fly   360 ILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNM--ELAVRLGVGLQLEEGNVTTES 422
            :||||.::.|:|:|.:.::.|.|...||::|:..|..:..||  ..|..:||.:|::.....|  
  Rat   288 LLAHPSIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGVSIQIQTLKAET-- 350

  Fly   423 LNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALF--------------WVNYVARHKGGSA 473
                         |..|:::| :|.:.....|:||.:.              |::::.:..|.:.
  Rat   351 -------------FARTMKEV-IEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAH 401

  Fly   474 LRTRGIGISSCQLHLFDLFVFYAGIATLVVSLLV 507
            |:.........:.:|.|:|:|..|:....|.|.|
  Rat   402 LKPYAFQQPWHEQYLLDVFLFLLGLTLGTVWLCV 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 91/392 (23%)
UDPGT 25..514 CDD:278624 99/424 (23%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 92/406 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.