powered by:
Protein Alignment Ugt317A1 and Y43D4A.2
DIOPT Version :9
Sequence 1: | NP_001286734.1 |
Gene: | Ugt317A1 / 37590 |
FlyBaseID: | FBgn0040091 |
Length: | 529 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_502984.3 |
Gene: | Y43D4A.2 / 189851 |
WormBaseID: | WBGene00012788 |
Length: | 151 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 15/59 - (25%) |
Similarity: | 24/59 - (40%) |
Gaps: | 21/59 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 427 VDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRG-IGISSC 484
::||..| :|.|.|.: |....|:||| .|::.|. :.:.||
Worm 33 IERLRAE-NFDLAITE--------PFDTCANALF-----------EAIKIRAHVAVLSC 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000004 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.