DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and ugt-60

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001021158.1 Gene:ugt-60 / 176366 WormBaseID:WBGene00007402 Length:507 Species:Caenorhabditis elegans


Alignment Length:518 Identity:102/518 - (19%)
Similarity:191/518 - (36%) Gaps:80/518 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ISQAAKILVLFPHVNEGHFAVMRTLVTELANREHTIEVYT--------------GHGLGESLDNV 71
            :..:.:||.:.|.....|......|...|....|.::::|              ..|:.|....:
 Worm    12 VVDSLRILQIVPGFTNSHVLFNYRLAETLRFLGHDVKMWTQMEMAMLDTGNNKLPEGVSEYRIPI 76

  Fly    72 TETVTAEFPFWSELQKQAAPKGNLADL---GLLPIEKLRQSLASVGARALDHFLAQEPIQKLLKM 133
            ..|.|.:.......|......|:..||   |        |....:...|.:..|..:      :.
 Worm    77 HFTDTLKTEGLKVFQSMMFESGDAHDLWWTG--------QEFKDMRVEACEQMLRHD------ES 127

  Fly   134 SYLEF---DFDVILVDYFYTEALLALG-ALHQRPVVGIISTDFGNYMDAVQEAL------VPAAC 188
            .|.:|   .|||.:. :|:....||:. .::.:.|:.|..........|||..|      :|...
 Worm   128 VYEDFRKDGFDVAIA-HFHDLCPLAIAKKMNVKRVIWITHGTSIYEFSAVQLGLRTIPSTIPHPL 191

  Fly   189 SPIDFERDQPEMSFSVRLGNI-------------RTCIARRKQFIKDHYGGQEQLVTKYFQLQSS 240
            |...|.:     .|..|:.|.             :..:.....|.::..|..          |..
 Worm   192 SSAGFSQ-----LFLDRVQNTLWHLSLLDFVNLPQNLLVDENLFYREFVGAD----------QDD 241

  Fly   241 IPELQASQLSVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKEL---PWNVKRFLEEARPGAIYV 302
            :.:|..:.:..||:|....|..|:.....|..:|.|.:...|:|   .| ::..:|:...|.|..
 Worm   242 LWDLAKTTVPSLLINGDRMLDFPRPLPIHIAFSGELGVSKGKKLVMEKW-LEDIIEKPSDGLIVF 305

  Fly   303 QLGNEQACGQLPKEKLDT-LFAFFSARKQSIIWTCHDVKTLEGLPK--NVMIQHAVPQIDILAHP 364
            .||.......:|.:.::: |.||...:..:|:|...  |::.|..|  |:.:...:||.||:.||
 Worm   306 SLGTVSNTTNMPAQMINSFLGAFGKLKTYTILWRME--KSVAGAEKYENLHLVKWLPQKDIMRHP 368

  Fly   365 RVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAVRLGVGLQLEEGNVTTESLNWAVDR 429
            ::|..:.:|...:..|.....:|.:.:|||..:..|.:.|.|.|:...|::.::|..::..|: :
 Worm   369 KMKLMIAHGGYNSFLEAAQAGIPAVLMPLFADQKINAKRAQRYGMATVLDKLDLTINNVYGAI-K 432

  Fly   430 LLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIGISSCQLHLFDLF 492
            ..|:..:....:.:|....|:......|||.:...:|.....|....:...:|..:.|..|:|
 Worm   433 EALKPEYSTNAKKLSAMLSDQVARKPYSALRYSLKLATSPKPSLFTLKSQHLSFLEFHNLDIF 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 98/500 (20%)
UDPGT 25..514 CDD:278624 102/514 (20%)
ugt-60NP_001021158.1 Glycosyltransferase_GTB_type 17..>161 CDD:299143 28/158 (18%)
egt <253..464 CDD:223071 52/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.