DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt317A1 and AT1G05675

DIOPT Version :9

Sequence 1:NP_001286734.1 Gene:Ugt317A1 / 37590 FlyBaseID:FBgn0040091 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001184915.1 Gene:AT1G05675 / 10723139 AraportID:AT1G05675 Length:453 Species:Arabidopsis thaliana


Alignment Length:476 Identity:93/476 - (19%)
Similarity:169/476 - (35%) Gaps:142/476 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LVLFPHVNEGHFAVMRTLVTELANR-------------------EH-TIEV-------YTGHGLG 65
            :::.|...:||...|......||::                   || ||.|       ..|....
plant     7 VIVLPFPAQGHITPMSQFCKRLASKSLKITLVLVSDKPSPPYKTEHDTITVVPISNGFQEGQERS 71

  Fly    66 ESLDNVTETVTAEFPFWSELQKQAAPKGNLADLGLLPIEKLRQSLASVGARALDHFLAQEPIQKL 130
            |.||...|.|.:..       |...||         .||.::              |:..|.:.|
plant    72 EDLDEYMERVESSI-------KNRLPK---------LIEDMK--------------LSGNPPRAL 106

  Fly   131 LKMSYLEFDFDV-----ILVDYFYTEALLALGALHQRPVVG---IISTDFGNYMDAVQEALVPAA 187
            :..|.:.:..||     :....|:|:..| :.|::.....|   :.||.:|:      ..|....
plant   107 VYDSTMPWLLDVAHSYGLSGAVFFTQPWL-VSAIYYHVFKGSFSVPSTKYGH------STLASFP 164

  Fly   188 CSPIDFERDQPEMSFSVRLGNIRTCIARRKQFIKDHYGGQEQLVTKYFQLQSSIPEL-QASQLSV 251
            ..||....|.|  ||        .|.:....:|                |::.|.:| ...::.:
plant   165 SLPILNANDLP--SF--------LCESSSYPYI----------------LRTVIDQLSNIDRVDI 203

  Fly   252 LLLNSH----------VPLITPKVSIQQIIPAGGLHIRGPKELPWNVKRF----------LEEAR 296
            :|.|:.          :..:.|.::|...:|:..|..|..::..:....|          |...:
plant   204 VLCNTFDKLEEKLLKWIKSVWPVLNIGPTVPSMYLDKRLAEDKNYGFSLFGAKIAECMEWLNSKQ 268

  Fly   297 PGA-IYVQLGNEQACGQLPKEKLDTLFAFFSARKQS---IIWTCHDVKTLEGLPKNVMIQHA--- 354
            |.: :||..|:      |...|.|.|....:..|||   .:|...:.:..: ||:|.:.:..   
plant   269 PSSVVYVSFGS------LVVLKKDQLIELAAGLKQSGHFFLWVVRETERRK-LPENYIEEIGEKG 326

  Fly   355 -----VPQIDILAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARN---MELAVRLGVGL 411
                 .||:::|.|..:..|:|:....:..||:...||::|:|.:..:..|   ||...::||.:
plant   327 LTVSWSPQLEVLTHKSIGCFVTHCGWNSTLEGLSLGVPMIGMPHWADQPTNAKFMEDVWKVGVRV 391

  Fly   412 QLE-EGNVTTESLNWAVDRLL 431
            :.: :|.|..|.....|:.::
plant   392 KADSDGFVRREEFVRRVEEVM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt317A1NP_001286734.1 Glycosyltransferase_GTB_type 22..477 CDD:299143 93/476 (20%)
UDPGT 25..514 CDD:278624 93/476 (20%)
AT1G05675NP_001184915.1 Glycosyltransferase_GTB-type 6..450 CDD:415824 93/476 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.