DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNJ2 and Irk1

DIOPT Version :9

Sequence 1:NP_000882.1 Gene:KCNJ2 / 3759 HGNCID:6263 Length:427 Species:Homo sapiens
Sequence 2:NP_001262861.1 Gene:Irk1 / 42742 FlyBaseID:FBgn0265042 Length:652 Species:Drosophila melanogaster


Alignment Length:381 Identity:182/381 - (47%)
Similarity:257/381 - (67%) Gaps:18/381 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     2 GSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTR---QQCRSRFVKKDGHCNVQFINVGE 63
            |:..:.:.||:.|....::.:..||:...|.......||   ::.|.|.|.|.|.|||...||.:
  Fly    96 GTQLSRKESILGSFHRQIRRSIKAVSESPGPLTRYRQTRFSSRRVRKRVVFKHGECNVVQGNVAK 160

Human    64 KGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLD------------AS 116
            :.:|||.|||||.||.:|||.|::|..:||.||.|||.::|:||..|.||:            |:
  Fly   161 RRRRYLQDIFTTLVDAQWRWTLLVFAASFVFSWAFFGFIWWIIAYAHNDLEYTNLKNQSPDLVAN 225

Human   117 KEGKACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVMA 181
            .....||::|::..:|||:|:|||||||||.|.||:|||.|:|.:..|.|.|..|.||::|.|.|
  Fly   226 ITHTVCVTQVSNMMSAFLYSVETQTTIGYGNRYVTEECPEAIFTMCIQCITGVFIQAFMVGIVFA 290

Human   182 KMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLD 246
            |:::||||.:||:||.||||..|||..|||:|||::||||::|||||||:::.::|.|||.:|..
  Fly   291 KLSRPKKRAQTLLFSRNAVICHRDGVPCLMFRVGDMRKSHIIEAHVRAQIIRKKVTKEGEVLPFY 355

Human   247 QIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTTQC 311
            |.::::|.|.|.||:..:.|.||||:||.:||||.||..|:....||:||:|||::|:|.||||.
  Fly   356 QQELHIGADGGEDRLMFIWPTTIVHKIDRNSPLYMLSASDMLKERFEVVVMLEGVIESTGMTTQA 420

Human   312 RSSYLANEILWGHRYEPVLF--EEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKK 365
            |||||.:|:|||||:..|:.  :|...|:|||:.|:.||:| :||||||:.|.|.|
  Fly   421 RSSYLPSEVLWGHRFVNVVSFRKETGEYEVDYTLFNNTYDV-DTPLCSAKQLDELK 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNJ2NP_000882.1 IRK_N 1..47 CDD:400662 10/47 (21%)
IRK 48..186 CDD:395797 71/149 (48%)
Selectivity filter. /evidence=ECO:0000250 142..147 4/4 (100%)
IRK_C 193..366 CDD:407551 95/175 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..427
PDZ-binding. /evidence=ECO:0000255 425..427
Irk1NP_001262861.1 IRK 145..477 CDD:279361 171/332 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 196 1.000 Domainoid score I3114
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20249
Inparanoid 1 1.050 363 1.000 Inparanoid score I2176
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8489
orthoMCL 1 0.900 - - OOG6_101017
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X128
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.