DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS24 and AT5G28060

DIOPT Version :10

Sequence 1:NP_611693.1 Gene:RpS24 / 37589 FlyBaseID:FBgn0261596 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_198158.1 Gene:AT5G28060 / 832878 AraportID:AT5G28060 Length:133 Species:Arabidopsis thaliana


Alignment Length:132 Identity:81/132 - (61%)
Similarity:103/132 - (78%) Gaps:1/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYKV-TPDVVFAFGFRTN 64
            |:....|||||.|||||||||||.|.||||||.::|:|.|::||||.||:| .|:.:|.|.|||:
plant     1 MAEKAVTIRTRNFMTNRLLARKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFCFKFRTH 65

  Fly    65 FGGGRSTGFALIYDTLDFAKKFEPKYRLARHGLFEQKKQTRKQRKERRNRMKKVRGTAKAKIGTG 129
            ||||:|:|:.|||||::.||||||||||.|:||..:.:::|||.|||:||.||:||..|.|.|..
plant    66 FGGGKSSGYGLIYDTVENAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIRGVKKTKAGDT 130

  Fly   130 KK 131
            ||
plant   131 KK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS24NP_611693.1 PTZ00071 7..131 CDD:240256 78/124 (63%)
AT5G28060NP_198158.1 PTZ00071 5..132 CDD:240256 78/126 (62%)

Return to query results.
Submit another query.