DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS24 and T07A9.14

DIOPT Version :10

Sequence 1:NP_611693.1 Gene:RpS24 / 37589 FlyBaseID:FBgn0261596 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001040986.1 Gene:T07A9.14 / 4363068 WormBaseID:WBGene00044789 Length:204 Species:Caenorhabditis elegans


Alignment Length:48 Identity:18/48 - (37%)
Similarity:28/48 - (58%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GFALIYDTLDFAKKFEPKYRLARHGLFEQKKQ-TRKQRKERRNRMKKV 118
            ||.|:|||.|||.|::|::.....|....:.. :|::.|.||.:..||
 Worm    54 GFTLVYDTFDFANKYQPEHSSNHDGASTSRTSISRRKEKRRREQAPKV 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS24NP_611693.1 PTZ00071 7..131 CDD:240256 18/48 (38%)
T07A9.14NP_001040986.1 None

Return to query results.
Submit another query.