DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS24 and T26G10.3

DIOPT Version :10

Sequence 1:NP_611693.1 Gene:RpS24 / 37589 FlyBaseID:FBgn0261596 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001366677.1 Gene:T26G10.3 / 188943 WormBaseID:WBGene00012060 Length:91 Species:Caenorhabditis elegans


Alignment Length:33 Identity:14/33 - (42%)
Similarity:21/33 - (63%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MVCDVLHPGLSSVNKTEIREKLAAMYKVTPDVV 56
            ||.:|:.||..:..|.:||||:|..|.:.||.:
 Worm     1 MVAEVILPGRPTTLKADIREKIANFYNINPDTM 33

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS24NP_611693.1 PTZ00071 7..131 CDD:240256 14/33 (42%)
T26G10.3NP_001366677.1 Ribosomal_S24e 2..80 CDD:460147 13/32 (41%)

Return to query results.
Submit another query.