Sequence 1: | NP_611692.1 | Gene: | CG3732 / 37588 | FlyBaseID: | FBgn0034750 | Length: | 282 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_564565.1 | Gene: | TAF15 / 841452 | AraportID: | AT1G50300 | Length: | 372 | Species: | Arabidopsis thaliana |
Alignment Length: | 266 | Identity: | 81/266 - (30%) |
---|---|---|---|
Similarity: | 106/266 - (39%) | Gaps: | 77/266 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 SNGGVASGAAGSSGVASP----GDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPE----RDRD 60
Fly 61 RDRERERGNGSSSSSSSSSKKKLGTEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNA 125
Fly 126 PKFSDVE--ERTGFGGGY---NDRGVVEYKDR----QDSDSE-YDEFGRRKKR------------ 168
Fly 169 -----------------KHG-------------EHREDSKRPRRSSRDEQRNDEEE-DEDDDEGD 202
Fly 203 DEDLSK 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3732 | NP_611692.1 | ZnF_RBZ | 22..46 | CDD:197784 | 12/23 (52%) |
RanBP2-type Zn finger | 24..45 | CDD:275376 | 10/20 (50%) | ||
zf-RanBP | 100..129 | CDD:279035 | 15/28 (54%) | ||
RanBP2-type Zn finger | 104..123 | CDD:275376 | 11/18 (61%) | ||
TAF15 | NP_564565.1 | RRM | <7..>97 | CDD:223796 | |
RRM_SARFH | 10..92 | CDD:240978 | |||
ZnF_RBZ | 137..162 | CDD:197784 | 13/29 (45%) | ||
RanBP2-type Zn finger | 139..160 | CDD:275376 | 10/20 (50%) | ||
ZnF_RBZ | 205..228 | CDD:197784 | 13/22 (59%) | ||
RanBP2-type Zn finger | 207..226 | CDD:275376 | 11/18 (61%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1995 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR12999 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |