DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3732 and TAF15

DIOPT Version :9

Sequence 1:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_564565.1 Gene:TAF15 / 841452 AraportID:AT1G50300 Length:372 Species:Arabidopsis thaliana


Alignment Length:266 Identity:81/266 - (30%)
Similarity:106/266 - (39%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SNGGVASGAAGSSGVASP----GDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPE----RDRD 60
            :|||...|...:...|.|    |||:||:..|.::|||.|..||:|     |:.:|.    ....
plant   115 TNGGAGRGRGQADSSAKPWQQDGDWMCPNTSCTNVNFAFRGVCNRC-----GTARPAGASGGSMG 174

  Fly    61 RDRERERGNGSSSSSSSSSKKKLGTEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNA 125
            ..|.|.||.|:.           |...||..:....|||...||.|..|.|||||:|..||:||.
plant   175 AGRGRGRGGGAD-----------GGAPGKQPSGAPTGLFGPNDWACPMCGNVNWAKRLKCNICNT 228

  Fly   126 PKFSDVE--ERTGFGGGY---NDRGVVEYKDR----QDSDSE-YDEFGRRKKR------------ 168
            .|....|  .|.|.||||   :::.:.|.|.|    ::.|.| |||||..||:            
plant   229 NKPGQNEGGVRGGRGGGYKELDEQELEETKRRRREAEEDDGEMYDEFGNLKKKYRVKTNQADTRP 293

  Fly   169 -----------------KHG-------------EHREDSKRPRRSSRDEQRNDEEE-DEDDDEGD 202
                             |.|             :|..|..|.|..||:.:|..|.: |.|.|...
plant   294 AVAAGRAGWEVEELGIDKDGRERSRDRQRDRGRDHHYDKDRRRSRSRERERGKERDYDYDHDRDR 358

  Fly   203 DEDLSK 208
            |.|..:
plant   359 DRDYGR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3732NP_611692.1 ZnF_RBZ 22..46 CDD:197784 12/23 (52%)
RanBP2-type Zn finger 24..45 CDD:275376 10/20 (50%)
zf-RanBP 100..129 CDD:279035 15/28 (54%)
RanBP2-type Zn finger 104..123 CDD:275376 11/18 (61%)
TAF15NP_564565.1 RRM <7..>97 CDD:223796
RRM_SARFH 10..92 CDD:240978
ZnF_RBZ 137..162 CDD:197784 13/29 (45%)
RanBP2-type Zn finger 139..160 CDD:275376 10/20 (50%)
ZnF_RBZ 205..228 CDD:197784 13/22 (59%)
RanBP2-type Zn finger 207..226 CDD:275376 11/18 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12999
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.