DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3732 and Taf15

DIOPT Version :9

Sequence 1:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_081703.1 Gene:Taf15 / 70439 MGIID:1917689 Length:557 Species:Mus musculus


Alignment Length:278 Identity:64/278 - (23%)
Similarity:80/278 - (28%) Gaps:99/278 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GAAGSSGVASPGDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPE----RDRDRDRER-ERGNG 70
            |..|..|....|||:||:..|.::|||||..||:|:..|....:|.    |.|....|| .||.|
Mouse   343 GFQGRGGDPKNGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGGERGYRGRG 407

  Fly    71 SSSSSSSSSKKKLGTEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNAPKFSDVEERT 135
            ..           |.:.|....|:|.|.:..                               :|:
Mouse   408 GR-----------GGDRGGYGGDRSGGGYGG-------------------------------DRS 430

  Fly   136 GFGGGY-NDRGVVEYKDRQDSDSEYDEFGRRKKRKHGEHREDSKRPRRSSRDEQRNDEEEDEDDD 199
              |||| .|||.....||..               :|..|..|....|......|.....|....
Mouse   431 --GGGYGGDRGGSYGGDRGG---------------YGGDRGGSYGGDRGGYGGDRGGYGGDRGGY 478

  Fly   200 EGDDEDLSKYDLWGDEEVTSTDVKSKEGTGNGDKERKRTSRDSTSSVSSSSSSSSSSSSDSSSSS 264
            .||     :....||           .|...||:.|                  .:...|...|.
Mouse   479 GGD-----RGGYGGD-----------RGGYGGDRSR------------------GAYGGDRGGSG 509

  Fly   265 SSSSSSGGRRKTSSSGRR 282
            |.|...||.|.....|.|
Mouse   510 SGSGGYGGDRSGGYGGDR 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3732NP_611692.1 ZnF_RBZ 22..46 CDD:197784 13/23 (57%)
RanBP2-type Zn finger 24..45 CDD:275376 11/20 (55%)
zf-RanBP 100..129 CDD:279035 0/28 (0%)
RanBP2-type Zn finger 104..123 CDD:275376 0/18 (0%)
Taf15NP_081703.1 RRM <221..>317 CDD:223796
RRM_FUS_TAF15 230..315 CDD:240979
zf-RanBP 352..382 CDD:279035 14/29 (48%)
RanBP2-type Zn finger 356..377 CDD:275376 11/20 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.