DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3732 and taf15

DIOPT Version :9

Sequence 1:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001073442.1 Gene:taf15 / 558760 ZFINID:ZDB-GENE-061215-102 Length:434 Species:Danio rerio


Alignment Length:182 Identity:50/182 - (27%)
Similarity:63/182 - (34%) Gaps:75/182 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GGVASGAAGSSGVAS----PGDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRDRDRERE 66
            ||...|..|..|..|    .|||.||:..|.::|||||.:||:|     |:.|||.|        
Zfish   320 GGGGGGGGGFGGGPSFDVRGGDWPCPNSSCGNMNFARRYECNRC-----GTPKPEGD-------- 371

  Fly    67 RGNGSSSSSSSSSKKKLGTEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNAPKFSDV 131
            ...|....|...|:...|.:.|    |:..|.                                 
Zfish   372 SFGGGGGGSDRGSRGGYGGDHG----DRGGGF--------------------------------- 399

  Fly   132 EERTGFGGGY--NDRGVVEYKDRQDSDSEYDEFGRRKKRKHGEHREDSK-RP 180
              |.|.|||:  .|||...||           .|.|     |:||:|.: ||
Zfish   400 --RGGRGGGFRGGDRGGGGYK-----------MGGR-----GDHRDDRRGRP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3732NP_611692.1 ZnF_RBZ 22..46 CDD:197784 13/23 (57%)
RanBP2-type Zn finger 24..45 CDD:275376 11/20 (55%)
zf-RanBP 100..129 CDD:279035 0/28 (0%)
RanBP2-type Zn finger 104..123 CDD:275376 0/18 (0%)
taf15NP_001073442.1 RRM <209..>297 CDD:223796
RRM_FUS_TAF15 209..291 CDD:240979
zf-RanBP 338..368 CDD:279035 15/34 (44%)
RanBP2-type Zn finger 342..363 CDD:275376 11/20 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.