DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3732 and fus

DIOPT Version :9

Sequence 1:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_957377.2 Gene:fus / 394058 ZFINID:ZDB-GENE-040426-1010 Length:541 Species:Danio rerio


Alignment Length:173 Identity:46/173 - (26%)
Similarity:60/173 - (34%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DGSD---KPERDRDRDRERERGNGSSSSSSSSSKKKLGTEIGKAAADKSR--------------- 96
            ||.|   .|.:.....|..|.|.|.||......:.: |..:|:......|               
Zfish   369 DGKDFNGNPIKVSFATRRAEFGRGGSSGGMRGGRGR-GGPMGRGGFGGGRGGGGGGGGFQGNNGG 432

  Fly    97 ------GLFSAEDWQCS--KCANVNWARRQTCNMCNAPK--------------FSDVEERTGFG- 138
                  |...|.||:||  .|.|:|::.|..||.|..||              |.....|:||. 
Zfish   433 GSGNGGGQQRAGDWKCSNPSCGNLNFSWRNECNQCKEPKPEGSGGGMSPMGGGFGGERGRSGFDR 497

  Fly   139 GGYNDRGVVEYKDRQDSDSEYDEFGRRKKRKHGEHREDSK-RP 180
            ||:..||......|.....:...||..|....|:||.|.: ||
Zfish   498 GGFRGRGGDRGGFRGGRGGDRGGFGPGKMDSRGDHRHDRRDRP 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3732NP_611692.1 ZnF_RBZ 22..46 CDD:197784
RanBP2-type Zn finger 24..45 CDD:275376
zf-RanBP 100..129 CDD:279035 14/44 (32%)
RanBP2-type Zn finger 104..123 CDD:275376 9/20 (45%)
fusNP_957377.2 RRM <274..>388 CDD:223796 5/18 (28%)
RRM_FUS_TAF15 297..382 CDD:240979 4/12 (33%)
zf-RanBP 443..472 CDD:279035 13/28 (46%)
RanBP2-type Zn finger 446..467 CDD:275375 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.