DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3732 and caz

DIOPT Version :9

Sequence 1:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_523365.2 Gene:caz / 32587 FlyBaseID:FBgn0285954 Length:399 Species:Drosophila melanogaster


Alignment Length:172 Identity:39/172 - (22%)
Similarity:46/172 - (26%) Gaps:56/172 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GGVASGAAGSSGVASPGDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRDRDRERERGNG 70
            ||...|..|..|....|                    .:.||...|..        .|....|.|
  Fly   227 GGRRGGGGGGGGGGGGG--------------------GRFDRGGGGGG--------GRYDRGGGG 263

  Fly    71 SSSSSSSSSKKKLGTEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNAPKFSDV-EER 134
            .......:.:.:.|                  ||:|:.|.|.|:|.|..||.|..||..|. ...
  Fly   264 GGGGGGGNVQPRDG------------------DWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSG 310

  Fly   135 TGFGGGYNDRGVVEYKDRQDSDSEYDEFGRRKKRKHGEHRED 176
            .|.||||...|         ....||....|.....|.|..|
  Fly   311 GGGGGGYGGGG---------GGGGYDRGNDRGSGGGGYHNRD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3732NP_611692.1 ZnF_RBZ 22..46 CDD:197784 1/23 (4%)
RanBP2-type Zn finger 24..45 CDD:275376 0/20 (0%)
zf-RanBP 100..129 CDD:279035 13/28 (46%)
RanBP2-type Zn finger 104..123 CDD:275376 9/18 (50%)
cazNP_523365.2 RRM <118..>205 CDD:223796
RRM_SARFH 122..204 CDD:240978
zf-RanBP 275..304 CDD:279035 14/46 (30%)
RanBP2-type Zn finger 279..298 CDD:275375 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1995
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.