DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3732 and AT2G26695

DIOPT Version :10

Sequence 1:NP_611692.1 Gene:CG3732 / 37588 FlyBaseID:FBgn0034750 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_973537.2 Gene:AT2G26695 / 2745562 AraportID:AT2G26695 Length:138 Species:Arabidopsis thaliana


Alignment Length:117 Identity:27/117 - (23%)
Similarity:41/117 - (35%) Gaps:38/117 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRDRDRERERGNGSSSSSSSSSKKKLGTE 86
            |||:|.  .|:|.||.:|..|.||...:.|                                |.:
plant     6 GDWLCG--ACQHANFKKRESCQKCGYPKFG--------------------------------GVD 36

  Fly    87 IGKAAADKSRGLFSAEDWQCS--KCANVNWARRQTCNMCNAPKFSDVEERTG 136
            :.....:::..:  |.||.|.  .|.:.|:|.|.:|..|...|....|:..|
plant    37 VSTYLYNRTEVM--AGDWYCGALNCGSHNYASRTSCYRCGMIKVEYTEQYYG 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3732NP_611692.1 RanBP2-type Zn finger 24..45 CDD:275376 8/20 (40%)
zf-RanBP 100..129 CDD:395516 11/30 (37%)
RanBP2-type Zn finger 104..123 CDD:275376 7/20 (35%)
AT2G26695NP_973537.2 RanBP2-type Zn finger 8..27 CDD:275375 8/20 (40%)
RanBP2-type Zn finger 52..73 CDD:275375 7/20 (35%)
RanBP2-type Zn finger 108..129 CDD:275375
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.