DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3732 and FUS

DIOPT Version :9

Sequence 1:	NP_611692.1	Gene:	CG3732 / 37588	FlyBaseID:	FBgn0034750	Length:	282	Species:	Drosophila melanogaster
Sequence 2:	NP_004951.1	Gene:	FUS / 2521	HGNCID:	4010	Length:	526	Species:	Homo sapiens

Alignment Length:	184	Identity:	47/184 - (25%)
Similarity:	61/184 - (33%)	Gaps:	75/184 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 GGVASGAAGSSGVASPGDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRDRDRERERGNG 70
            ||..||..|..|....|||.||:..|.::||:.|.:||:|.     :.||:....       |.|
Human   408 GGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCK-----APKPDGPGG-------GPG 460

  Fly    71 SSSSSSSSSKKKLGTEIGKAAADK--------SRGLFSAEDWQCSKCANVNWARRQTCNMCNAPK 127
            .|....:....:.|   |:...|:        .||.|
Human   461 GSHMGGNYGDDRRG---GRGGYDRGGYRGRGGDRGGF---------------------------- 494

  Fly   128 FSDVEERTGFGGGYNDRGVVEYKDRQDSDSEYDEFGRRKKRKHGEHREDSK-RP 180
                  |.|.|||  |||               .||..|....||||:|.: ||
Human   495 ------RGGRGGG--DRG---------------GFGPGKMDSRGEHRQDRRERP 525

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3732	NP_611692.1	ZnF_RBZ	22..46	CDD:197784	11/23 (48%)
		RanBP2-type Zn finger	24..45	CDD:275376	9/20 (45%)
		zf-RanBP	100..129	CDD:279035	0/28 (0%)
		RanBP2-type Zn finger	104..123	CDD:275376	0/18 (0%)
FUS	NP_004951.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..286
		RRM_FUS_TAF15	283..368	CDD:240979
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	375..424		6/15 (40%)
		zf-RanBP	422..449	CDD:279035	12/31 (39%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	444..526		32/148 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1995
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810