DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and MRPS28

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_010624.3 Gene:MRPS28 / 851937 SGDID:S000002745 Length:286 Species:Saccharomyces cerevisiae


Alignment Length:110 Identity:30/110 - (27%)
Similarity:57/110 - (51%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DCKELDKADESVKSLFKLSNNASYLTTKFYRDEMVKEVQRHAQDFGSMEAKLAKMTAVIRRYQEH 127
            |.::|:...|::..:..:.|:.:....|...:...||.:|...|.||.|.:.|.||..|:....|
Yeast   127 DIEKLEDRREAILRILSMRNSENKNAIKMAVELARKEFERFPGDTGSSEVQAACMTVRIQNMANH 191

  Fly   128 MDKHPRDKMIKVRLKELIDKRKKFLKYLRRWDYPRFEWILEKLDL 172
            :.:|.:|......|:.|:.:|:..|:||:|.:..::.|.::||.|
Yeast   192 IKEHRKDFANTRNLRILVQQRQAILRYLKRDNPEKYYWTIQKLGL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 24/74 (32%)
MRPS28NP_010624.3 Ribosomal_S15 161..236 CDD:395247 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342118
Domainoid 1 1.000 49 1.000 Domainoid score I2973
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 1 1.000 - - oto99785
orthoMCL 1 0.900 - - OOG6_101240
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1262
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.630

Return to query results.
Submit another query.