DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and AT1G80620

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_849914.1 Gene:AT1G80620 / 844401 AraportID:AT1G80620 Length:414 Species:Arabidopsis thaliana


Alignment Length:217 Identity:52/217 - (23%)
Similarity:83/217 - (38%) Gaps:61/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VREYAFKSDLKIKWMRP----EKIACYKPEKSGD------------LAKLPPLKADE-------- 56
            |.|...||:. ||...|    ||:..|:||...:            |.||..::.::        
plant   199 VTEEEMKSEF-IKSYDPIELGEKLRLYRPEGKKEEGWFSLQELNQRLVKLRAMEEEQFQKTSIVH 262

  Fly    57 ------LLPEYRDCKELDKAD--ESVKSLFKLSNNASYL---------TTKFYRDEMV------- 97
                  |..|:....:..|:|  ::......||....|:         .|.|:.|.|.       
plant   263 PSFVNNLRSEFHKFTKAQKSDPFQNTNIWGVLSGTPKYMLEPPKDQLVETYFHPDNMSSAEKMKI 327

  Fly    98 ------KEVQRHAQDFGSMEAKLAKMTAVIRRYQEHMDK--HPRDKMIKVRLKELIDKRKKFLKY 154
                  :|.:....|.||...::|::|..|:    |:..  |.:||..:..|..::.:|||.|||
plant   328 ELAKVREEFKMSESDCGSARVQVAQLTTKIK----HLSSVLHKKDKHSRKGLIAMVQRRKKLLKY 388

  Fly   155 LRRWDYPRFEWILEKLDLVYKP 176
            :||.|:..:...|.||.|...|
plant   389 MRRTDWDSYCLSLSKLGLRDNP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 24/89 (27%)
AT1G80620NP_849914.1 Ribosomal_S15 333..406 CDD:278728 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101240
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.