DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and AT1G15810

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_563982.1 Gene:AT1G15810 / 838150 AraportID:AT1G15810 Length:419 Species:Arabidopsis thaliana


Alignment Length:185 Identity:48/185 - (25%)
Similarity:80/185 - (43%) Gaps:31/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLLNIAQAGHRQFVREYAFKSDLKIKWMRPEKIACYKPEKS-----------GDLAKLPPLKADE 56
            :|:.:.|...::  .:|..|:..:::    ..|:.:|.|.|           |.|..:|..|   
plant   251 RLVKLRQVEEKE--AQYRTKNFAQLR----NVISSFKNENSEASSQQNVAIMGHLGGIPEYK--- 306

  Fly    57 LLPEYRDCKELDKADESVKSLFKLSNNASYLTTKFYRDEMVKEVQRHAQDFGSMEAKLAKMTAVI 121
            |||...|.         |.:.|...|.:|....|....::.:|.:....|.||...::|::|..|
plant   307 LLPPKEDL---------VDTYFHPDNMSSAEKMKIELSKVREEFKMSESDCGSARVQVAQLTTKI 362

  Fly   122 RRYQEHMDKHPRDKMIKVRLKELIDKRKKFLKYLRRWDYPRFEWILEKLDLVYKP 176
            :.....:  |.:||..:..|..::.||||.||||||.|:..:..:|.||.|...|
plant   363 KHLSSSL--HKKDKHSRKGLLGMVQKRKKLLKYLRRTDWDSYCLVLSKLSLRDNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 25/74 (34%)
AT1G15810NP_563982.1 Ribosomal_S15 338..411 CDD:376314 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 1 1.000 - - oto3881
orthoMCL 1 0.900 - - OOG6_101240
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.