DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and Mrps15

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_079820.2 Gene:Mrps15 / 66407 MGIID:1913657 Length:258 Species:Mus musculus


Alignment Length:228 Identity:65/228 - (28%)
Similarity:104/228 - (45%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PPLKADELLPEYRD-CKELDKADESVKSLFKLSNNASYLTTKFYRDEMVKEVQRHAQDFGSMEAK 113
            ||..|  .:.||:| ...::|.|:.||.:..|...:.....|..:::::.::..:.:|..::||:
Mouse    67 PPSSA--FIKEYKDIIPNIEKVDDVVKRILSLEMASRKEKLKIKQEQLMNKIVENPEDSRTLEAQ 129

  Fly   114 LAKMTAVIRRYQEHMDKHPRDKMIKVRLKELIDKRKKFLKYLRRWDYPRFEWILEKLDLVYKPPP 178
            :..:|..||.|:|||.||.:||..|..|...||:|||.||.||:.:|..||...::|.:.|..||
Mouse   130 IIALTVRIRNYEEHMQKHRKDKAHKRHLLMSIDRRKKLLKILRQTNYDVFEKTCKELGVEYTLPP 194

  Fly   179 THFHWITRKESLQKLTDIYCENLKEERLEAYHKQLQAQQIPFLEEAIKKMQFVRQEQISCDVPVT 243
            .||         ||:                |::..|          ||...:|..|        
Mouse   195 LHF---------QKV----------------HRRFLA----------KKALCIRVYQ-------- 216

  Fly   244 VTEEKIADSKRQLEMLKELQQAEAAASSKKQNE 276
             ..:|:...||.|       :|.|||:.|::||
Mouse   217 -EVQKLKKQKRAL-------KAAAAAAKKEKNE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 29/74 (39%)
Mrps15NP_079820.2 Ribosomal_S15 113..187 CDD:278728 28/73 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..258 7/13 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833738
Domainoid 1 1.000 60 1.000 Domainoid score I10594
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 1 1.000 - - oto93936
orthoMCL 1 0.900 - - OOG6_101240
Panther 1 1.100 - - LDO PTHR46685
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1262
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.