DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and mrps15

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_012812478.1 Gene:mrps15 / 549820 XenbaseID:XB-GENE-1016472 Length:261 Species:Xenopus tropicalis


Alignment Length:215 Identity:68/215 - (31%)
Similarity:97/215 - (45%) Gaps:42/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VREYAFKSDLKIKWMRPEKIACYKPEKSGDLAKLPPLKADELLPEYRDCKELDKADESVKSLFKL 80
            ||.||       :..|.::|    |.:..|   |||..   |..||...:..|..|:.||.|..|
 Frog    52 VRNYA-------QTRRRQEI----PSQLDD---LPPTM---LKTEYTGVQLSDAVDDVVKRLLSL 99

  Fly    81 SNNASYLTTKFYRDEMVKEVQRHAQDFGSMEAKLAKMTAVIRRYQEHMDKHPR------------ 133
            ...:.....|....::|.:|:|...|..|.|.::|.:||.||.|:||:.|||:            
 Frog   100 EMASQAEKLKIKTQQLVDKVKRDPHDTRSPEVRIAALTAKIRNYREHIQKHPKTVMNNLCVSFHS 164

  Fly   134 -DKMIKVRLKELIDKRKKFLKYLRRWDYPRFEWILEKLDLVYKPPPTHFHWITRKESLQKLTDIY 197
             ||..|.::...||||||.||.||...|..||.:..:|.:.|..||.::...||:...:|   ..
 Frog   165 EDKSNKRKMLMAIDKRKKMLKNLRLTRYDAFEHVCAQLGIEYTFPPEYYRRATRRWLAKK---AL 226

  Fly   198 CENLKEERLEAYH--KQLQA 215
            |       |:.|:  |:|||
 Frog   227 C-------LKVYNEAKRLQA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 34/87 (39%)
mrps15XP_012812478.1 Ribosomal_S15 116..204 CDD:278728 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10652
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5051
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1539741at2759
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 1 1.000 - - oto104159
Panther 1 1.100 - - LDO PTHR46685
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1262
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.190

Return to query results.
Submit another query.