DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and RpS13

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001033885.1 Gene:RpS13 / 34149 FlyBaseID:FBgn0010265 Length:151 Species:Drosophila melanogaster


Alignment Length:114 Identity:20/114 - (17%)
Similarity:39/114 - (34%) Gaps:24/114 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DKADESVKSLFK-----------LSNNASYLTTKFYRDEMVKEVQRHA---QDFGSMEAKLAKMT 118
            |...|.:|.|.|           |.::......:|.....:..:.:..   .|.......:.|..
  Fly    31 DDVKEQIKKLGKKGLTPSKIGIILRDSHGVAQVRFVNGNKILRIMKSVGLKPDIPEDLYHMIKKA 95

  Fly   119 AVIRRYQEHMDKHPRDKMIKVRLKELIDKRKKFLKYLR-------RWDY 160
            ..||:   |::::.:||..|.||..:..:..:..:|.:       .|.|
  Fly    96 VAIRK---HLERNRKDKDGKFRLILVESRIHRLARYYKTKSVLPPNWKY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 13/74 (18%)
RpS13NP_001033885.1 PTZ00072 4..151 CDD:185427 20/114 (18%)
Ribosomal_S13_N 4..60 CDD:285331 6/28 (21%)
Ribosomal_S15p_S13e 70..145 CDD:238213 13/75 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.