DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and mrps28

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_595624.1 Gene:mrps28 / 2539962 PomBaseID:SPBC11B10.04c Length:288 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:40/159 - (25%)
Similarity:69/159 - (43%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EKIACYKPEKSGDLAKLPPL----KADELLPEYRDCKE---------------LDKADESVKSLF 78
            |||.....|::.|..||..:    .:|..|...:|..|               .|...||:..:|
pombe   119 EKIRASATEETKDFIKLNEVNEFPSSDTSLESNQDGFERLHPLAERLERMSQLSDLRKESIHRIF 183

  Fly    79 KLSNNASYLTTKFYRDEMVKEVQRHAQDFGSMEAKLAKMTAVIRRYQEHMDKHPRDKMIKVRLKE 143
            .:.|:.|.......:...|:...|:.:|.||.|.:.|..|:.|....:|...|.:|:..|..|:.
pombe   184 NIENSNSKTLRLNNKQLAVESFARNERDTGSPEVQAAVYTSRILALSDHCKNHKKDQTGKRMLRY 248

  Fly   144 LIDKRKKFLKYLRRWDYPRFEWILEKLDL 172
            .:.:|::.|||||:.::.|:...::.|.|
pombe   249 YVHQRQRMLKYLRKVNFDRYVHCIKNLGL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 22/74 (30%)
mrps28NP_595624.1 RpsO 191..277 CDD:223262 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I3584
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003129
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101240
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1262
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.