DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bonsai and rps-13

DIOPT Version :9

Sequence 1:NP_611691.1 Gene:bonsai / 37587 FlyBaseID:FBgn0026261 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_498393.1 Gene:rps-13 / 175901 WormBaseID:WBGene00004482 Length:151 Species:Caenorhabditis elegans


Alignment Length:51 Identity:12/51 - (23%)
Similarity:21/51 - (41%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LAKMTAVIRRYQEHMDKHPRDKMIKVRLKELIDKRKKFLKYLRR----WDY 160
            |.|....||::.|...|....|...:.::..|.:..::.|..|:    |.|
 Worm    91 LVKKAVAIRKHLERSRKDIDSKYRLILVESRIHRLARYYKTKRQLPPTWKY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bonsaiNP_611691.1 Ribosomal_S15 97..172 CDD:278728 12/51 (24%)
rps-13NP_498393.1 PTZ00072 4..151 CDD:185427 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.