DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and CTK1

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_012783.1 Gene:CTK1 / 853718 SGDID:S000001622 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:427 Identity:145/427 - (33%)
Similarity:225/427 - (52%) Gaps:62/427 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MSHMLQQPSGSTPSNVGSSSSRT-----------------------------MSLMEKQKYIEDY 39
            :||:.:.|.....|...:||:.:                             :|::.:|:     
Yeast   119 LSHLPKGPKSVEKSRYNNSSNTSNDIKNGYHASKYYNHKGQEGRSVIAKKVPVSVLTQQR----- 178

  Fly    40 DFPYCDESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQL 104
                  .::.|.::.::|:||:|:|:||: ....:|.||:||:.:..|:||||||::|||::||.
Yeast   179 ------STSVYLRIMQVGEGTYGKVYKAK-NTNTEKLVALKKLRLQGEREGFPITSIREIKLLQS 236

  Fly   105 LKHENVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGL 169
            ..|.||..:.||....       :.|.|::|::.::||:|||.|..|:.|..:.|.:.:|||.|:
Yeast   237 FDHPNVSTIKEIMVES-------QKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGM 294

  Fly   170 YYIHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLG 234
            .|:|.|||||||:|.:|:||...|.||:.||||||     |..|:..|||||:||||||||||||
Yeast   295 EYLHDNKILHRDVKGSNILIDNQGNLKITDFGLAR-----KMNSRADYTNRVITLWYRPPELLLG 354

  Fly   235 DRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIEL 299
            ..|||..|||||.||::.|::.::.|.||:.|.:|:..|.::.|:.|.:.||.:.::..:..| :
Yeast   355 TTNYGTEVDMWGCGCLLVELFNKTAIFQGSNELEQIESIFKIMGTPTINSWPTLYDMPWFFMI-M 418

  Fly   300 PKNQKRRV---KERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLS 361
            |:...:.|   .|:.:..:.......|...||..|..||..|..||..|:|..:|.|..|   :.
Yeast   419 PQQTTKYVNNFSEKFKSVLPSSKCLQLAINLLCYDQTKRFSATEALQSDYFKEEPKPEPL---VL 480

  Fly   362 QHLQSMFEYLAQPRRSNQMRNYHQQLTTMNQKPQDNS 398
            ..|.|..||..:..|..:..|...  |..|.|...||
Yeast   481 DGLVSCHEYEVKLARKQKRPNILS--TNTNNKGNGNS 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 122/312 (39%)
CTK1NP_012783.1 STKc_CDK9_like 183..469 CDD:270832 122/299 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 253 1.000 Domainoid score I332
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I683
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.