DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT1G71530

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_177308.3 Gene:AT1G71530 / 843493 AraportID:AT1G71530 Length:655 Species:Arabidopsis thaliana


Alignment Length:365 Identity:141/365 - (38%)
Similarity:203/365 - (55%) Gaps:43/365 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MSHMLQQPSGSTPSNVGSSSSRTMSLMEKQKYIEDYDFPYCDESNKYEKVAKIGQGTFGEVFKAR 68
            :|:..:.|:...||.:.|.:...         |:.: .|.|.||  :||:.||||||:..|:|||
plant   113 ISNKTELPAAEWPSWLASVAGEA---------IKGW-VPRCAES--FEKLDKIGQGTYSSVYKAR 165

  Fly    69 EKKGNKKFVAMKKVL---MDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRST 130
            :.: ..|.||||||.   ||.|...|   ..|||.||:.|.|.||:.|      :...|:....:
plant   166 DLE-TGKIVAMKKVRFVNMDPESVRF---MAREILILRKLDHPNVMKL------EGLVTSRLSGS 220

  Fly   131 FYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGIL 195
            .||||::.|||||||.:...:|||..:||..||||..||.:.|...|||||:|.:|:||...|:|
plant   221 LYLVFEYMEHDLAGLAATPGIKFSEPQIKCYMQQLFRGLEHCHRRGILHRDIKGSNLLINNEGVL 285

  Fly   196 KLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPI 260
            |:.|||||..:   :.:...:.|:||||||||.||||||...|||.:|:|.||||:.|::...||
plant   286 KIGDFGLANFY---RGDGDLQLTSRVVTLWYRAPELLLGATEYGPAIDLWSAGCILTELFAGKPI 347

  Fly   261 MQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRVKERLRPYVKD------QT 319
            |.|.||.:|:..|.:||||.:.|.|         :...||.....:.....:|.:.:      .:
plant   348 MPGRTEVEQMHKIFKLCGSPSEDYW---------RRATLPLATSFKPSHPYKPVLAETFNHFPSS 403

  Fly   320 GCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKM 359
            ...|::|||.::|:||..|.:.|..:||.|:|:|::.|.:
plant   404 ALMLINKLLAIEPEKRGSAASTLRSEFFTTEPLPANPSNL 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 129/318 (41%)
AT1G71530NP_177308.3 STKc_CDK9_like 147..431 CDD:270832 125/305 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.