DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT1G67580

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001154456.1 Gene:AT1G67580 / 843079 AraportID:AT1G67580 Length:752 Species:Arabidopsis thaliana


Alignment Length:388 Identity:142/388 - (36%)
Similarity:220/388 - (56%) Gaps:50/388 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HMSHMLQQPSGSTPSNVGSSSSRTMSLMEKQKYIEDYDFPYCDESNKYEKVAKIGQGTFGEVFKA 67
            ::.|...:|: |||       .|::::::.           |...:::|::.||.:||:|.|::|
plant   378 YVRHETPEPA-STP-------LRSINMLQG-----------CRSVDEFERLNKIDEGTYGVVYRA 423

  Fly    68 REKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLIEICRTKATATNGYRSTFY 132
            ::|| ..:.||:|||.|:.|:||||:|:||||.||....|.::|::.|:      .......:.:
plant   424 KDKK-TGEIVALKKVKMEKEREGFPLTSLREINILLSFHHPSIVDVKEV------VVGSSLDSIF 481

  Fly   133 LVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSNKILHRDMKAANVLITKHGILKL 197
            :|.::.||||..|:..|..:||..|:|.:|.|||.|:.|:|.|.:||||:|.:|:|:...|.||:
plant   482 MVMEYMEHDLKALMETMKQRFSQSEVKCLMLQLLEGVKYLHDNWVLHRDLKTSNLLLNNRGELKI 546

  Fly   198 ADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPVDMWGAGCIMAEMWTRSPIMQ 262
            .||||||.:..|...    ||:.|||||||.||||||.:.|...:|||..||||||:..::|:..
plant   547 CDFGLARQYGSPLKP----YTHLVVTLWYRAPELLLGAKQYSTAIDMWSLGCIMAELLMKAPLFN 607

  Fly   263 GNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRVKERL-------RPYVKDQTG 320
            |.||..||..|.::.|:....:|||..:|...| :...|:|...::::.       .|.:.| .|
plant   608 GKTEFDQLDKIFRILGTPNESIWPGFSKLPGVK-VNFVKHQYNLLRKKFPATSFTGAPVLSD-AG 670

  Fly   321 CDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSD---LSKMLSQHLQSMFEYLAQPRRSNQM 380
            .|||:||||.||::||..:.||.||:|...|:|..   :....:||        ||.||..:|
plant   671 FDLLNKLLTYDPERRITVNEALKHDWFREVPLPKSKDFMPTFPAQH--------AQDRRGRRM 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 126/316 (40%)
AT1G67580NP_001154456.1 STKc_CDC2L1 400..697 CDD:173741 126/309 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.