DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT1G54610

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001117490.1 Gene:AT1G54610 / 841903 AraportID:AT1G54610 Length:572 Species:Arabidopsis thaliana


Alignment Length:323 Identity:140/323 - (43%)
Similarity:195/323 - (60%) Gaps:30/323 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ESNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDN-EKEGFPITALREIRILQLLKHEN 109
            :::.:||:.||||||:..|:||::.. ..|.||:|||..|| |.|.....| |||.:|:.|.|.|
plant   114 KADTFEKIDKIGQGTYSNVYKAKDML-TGKIVALKKVRFDNLEPESVKFMA-REILVLRRLDHPN 176

  Fly   110 VVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHS 174
            ||.|      :...|:....:.||||.:.:||||||.|:..||||..|:|.:|:||::||.:.||
plant   177 VVKL------EGLVTSRMSCSLYLVFQYMDHDLAGLASSPVVKFSESEVKCLMRQLISGLEHCHS 235

  Fly   175 NKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYG 239
            ..:||||:|.:|:||...|:||:||||||..|. |.:  |...|:||||||||.||||||..:||
plant   236 RGVLHRDIKGSNLLIDDGGVLKIADFGLATIFD-PNH--KRPMTSRVVTLWYRAPELLLGATDYG 297

  Fly   240 PPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWP------GVEELELYKSIE 298
            ..:|:|.||||:||:....|||.|.||.:||..|.:||||.:.|.|.      |.    :||..|
plant   298 VGIDLWSAGCILAELLAGRPIMPGRTEVEQLHKIYKLCGSPSEDYWKKGKFTHGA----IYKPRE 358

  Fly   299 LPKNQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPM---PSDLSK 358
               ..||.::|..:.:  ..:...|:|.||:::|:.|..|..||..:||.::|.   |:||.|
plant   359 ---PYKRSIRETFKDF--PPSSLPLIDALLSIEPEDRQTASAALKSEFFTSEPYACEPADLPK 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 133/307 (43%)
AT1G54610NP_001117490.1 STKc_CDK9_like 118..402 CDD:270832 133/303 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.