DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT1G33770

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_174637.1 Gene:AT1G33770 / 840268 AraportID:AT1G33770 Length:614 Species:Arabidopsis thaliana


Alignment Length:320 Identity:137/320 - (42%)
Similarity:193/320 - (60%) Gaps:27/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVL---MDNEKEGFPITALREIRILQLLKHE 108
            ::.:||:.||||||:..|:|||:.: ..|.||||||.   ||.|...|   ..|||.||:.|.|.
plant   138 ADSFEKLDKIGQGTYSIVYKARDLE-TGKIVAMKKVRFANMDPESVRF---MAREINILRKLDHP 198

  Fly   109 NVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIH 173
            ||:.|      :...|:....:.:|||::.||||:||.....|||:..:||..|:|||.||.:.|
plant   199 NVMKL------QCLVTSKLSGSLHLVFEYMEHDLSGLALRPGVKFTEPQIKCFMKQLLCGLEHCH 257

  Fly   174 SNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNY 238
            |..|||||:|.:|:|:...|:||:.|||||   |..|.:.....|:||||||||.||||||...|
plant   258 SRGILHRDIKGSNLLVNNDGVLKIGDFGLA---SFYKPDQDQPLTSRVVTLWYRAPELLLGSTEY 319

  Fly   239 GPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVE--ELELYKSIELPK 301
            ||.:|:|..|||:||::...|||.|.||.:|:..|.:||||.:.:.|...:  :...||    |:
plant   320 GPAIDLWSVGCILAELFVCKPIMPGRTEVEQMHKIFKLCGSPSEEFWNTTKFPQATSYK----PQ 380

  Fly   302 NQKRRVKERLRPYVKD--QTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKM 359
            :..:||   |....|:  .:..|||||||:::|:||..|.:.|..:||.|:|:|..:|.:
plant   381 HPYKRV---LLETFKNLSSSSLDLLDKLLSVEPEKRCSASSTLLSEFFTTEPLPCHISSL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 131/306 (43%)
AT1G33770NP_174637.1 STKc_CDK9_like 141..425 CDD:270832 131/303 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.