DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT1G03740

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_171870.4 Gene:AT1G03740 / 839423 AraportID:AT1G03740 Length:740 Species:Arabidopsis thaliana


Alignment Length:357 Identity:141/357 - (39%)
Similarity:202/357 - (56%) Gaps:45/357 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMD-NEKEGFPITALREIRILQLLKHENV 110
            :|.:||:.||||||:..|::||:...| |.||:|||..| |:.|.....| |||.:::.|.|.||
plant   210 ANTFEKLEKIGQGTYSSVYRARDLLHN-KIVALKKVRFDLNDMESVKFMA-REIIVMRRLDHPNV 272

  Fly   111 VNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSN 175
            :.|      :...|....|:.||||::.:|||.||.|...|||:..::|..|:|||:||.:.||.
plant   273 LKL------EGLITAPVSSSLYLVFEYMDHDLLGLSSLPGVKFTEPQVKCYMRQLLSGLEHCHSR 331

  Fly   176 KILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGP 240
            .:||||:|.:|:||...|:||:||||||..|...|:.|   .|:.||||||||||||||..:||.
plant   332 GVLHRDIKGSNLLIDSKGVLKIADFGLATFFDPAKSVS---LTSHVVTLWYRPPELLLGASHYGV 393

  Fly   241 PVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKN--- 302
            .||:|..|||:.|::...||:.|.||.:||..|.:||||.|.:.|         :..:||.:   
plant   394 GVDLWSTGCILGELYAGKPILPGKTEVEQLHKIFKLCGSPTENYW---------RKQKLPSSAGF 449

  Fly   303 -----QKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPM---PSDL--- 356
                 .:|:|.|..:.:  ..:...||:.||::||..|..||.||..::|.|.|.   ||:|   
plant   450 KTAIPYRRKVSEMFKDF--PASVLSLLETLLSIDPDHRSSADRALESEYFKTKPFACDPSNLPKY 512

  Fly   357 --SKMLSQHLQSMFEYLAQPRRSNQMRNYHQQ 386
              ||.:...::.      :.:|...||...|:
plant   513 PPSKEIDAKMRD------EAKRQQPMRAEKQE 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 129/308 (42%)
AT1G03740NP_171870.4 STKc_CDK9_like 213..497 CDD:270832 128/305 (42%)
S_TKc 213..497 CDD:214567 128/305 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.