DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and CDKC2

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_201301.1 Gene:CDKC2 / 836620 AraportID:AT5G64960 Length:513 Species:Arabidopsis thaliana


Alignment Length:354 Identity:163/354 - (46%)
Similarity:230/354 - (64%) Gaps:19/354 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLI 114
            :||:.:||:||:|:|:.|:|.| ..:.||:||:.||||:|||||||:|||:||:.|.||||::|.
plant    26 FEKLEQIGEGTYGQVYMAKEIK-TGEIVALKKIRMDNEREGFPITAIREIKILKKLHHENVIHLK 89

  Fly   115 EICRTKA--------TATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYY 171
            ||..:..        ...|.|:...|:||::.:|||.||.....::|::.:||..|:|||.||:|
plant    90 EIVTSPGRDRDDQGKPDNNKYKGGIYMVFEYMDHDLTGLADRPGLRFTVPQIKCYMKQLLTGLHY 154

  Fly   172 IHSNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDR 236
            .|.|::||||:|.:|:||...|.||||||||||::|   ::.....||||:||||||||||||..
plant   155 CHVNQVLHRDIKGSNLLIDNEGNLKLADFGLARSYS---HDHTGNLTNRVITLWYRPPELLLGAT 216

  Fly   237 NYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPK 301
            .|||.:|||..|||.||:....||:.|.||.:||..|.:||||.....||||.::..|..::..:
plant   217 KYGPAIDMWSVGCIFAELLNGKPILPGKTENEQLNKIYELCGSPDESNWPGVSKMPWYNQMKSSR 281

  Fly   302 NQKRRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPMPSDLSKMLSQHLQS 366
            ..||||:|..|.:  |:...:||:|:|.|||.:||.|..||:.::|||||:|.| .|.|..: :|
plant   282 PLKRRVREIYRHF--DRHALELLEKMLVLDPSQRICAKDALDAEYFWTDPLPCD-PKSLPTY-ES 342

  Fly   367 MFEYLAQPRRSNQMRNYHQQLTTMNQKPQ 395
            ..|:..:.:| .|||  |.:.....||.|
plant   343 SHEFQTKKKR-QQMR--HNEEAAKKQKLQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 144/304 (47%)
CDKC2NP_201301.1 STKc_CDK9_like 26..325 CDD:270832 144/304 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 305 1.000 Inparanoid score I761
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
88.030

Return to query results.
Submit another query.