DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT5G44290

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001032009.1 Gene:AT5G44290 / 834452 AraportID:AT5G44290 Length:644 Species:Arabidopsis thaliana


Alignment Length:370 Identity:144/370 - (38%)
Similarity:214/370 - (57%) Gaps:37/370 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SNKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMD-NEKEGFPITALREIRILQLLKHENV 110
            ::.:||:.||||||:..|:|||:.. |.|.||:|:|..| ::.|.....| |||.:::.|.|.||
plant   134 ASTFEKLEKIGQGTYSSVYKARDLT-NNKIVALKRVRFDLSDLESVKFMA-REIIVMRRLDHPNV 196

  Fly   111 VNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIHSN 175
            :.|      :...|....|:.||||::.:|||.||.|...:|||..::|..|||||:||::.||.
plant   197 LKL------EGLITASVSSSLYLVFEYMDHDLVGLASIPGIKFSEPQVKCYMQQLLSGLHHCHSR 255

  Fly   176 KILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGP 240
            .:||||:|.:|:||..:|:||:||||||..|. |:|...  .|:|||||||||||||||..:||.
plant   256 GVLHRDIKGSNLLIDSNGVLKIADFGLATFFD-PQNCVP--LTSRVVTLWYRPPELLLGACHYGV 317

  Fly   241 PVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQK- 304
            .||:|..|||:.|:::..||:.|.||.:||..|.:||||.|.|.|         :.::||.:.. 
plant   318 GVDLWSTGCILGELYSGKPILAGKTEVEQLHKIFKLCGSPTEDYW---------RKLKLPPSAAF 373

  Fly   305 -------RRVKERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPM---PSDLSKM 359
                   |||.|..:....:.  ..||:.||::||.:|..|..||..::|.|:|.   ||.|.|.
plant   374 RPALPYGRRVAEMFKDLPTNV--LSLLEALLSIDPDRRGSAARALESEYFRTEPFACDPSSLPKY 436

  Fly   360 -LSQHLQSMFEYLAQPRRSNQMRNYHQQLTTMNQKPQDNSMIDRV 403
             .|:.:.:.....|:.:|..|.:  |::..:..::..:..:|..|
plant   437 PPSKEIDAKIRDDAKRQRPTQEK--HERQDSQTRRSHERKLIPPV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 130/308 (42%)
AT5G44290NP_001032009.1 STKc_CDK9_like 137..421 CDD:270832 130/305 (43%)
S_TKc 137..421 CDD:214567 130/305 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.