DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk9 and AT3G05050

DIOPT Version :9

Sequence 1:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001326094.1 Gene:AT3G05050 / 819667 AraportID:AT3G05050 Length:593 Species:Arabidopsis thaliana


Alignment Length:327 Identity:139/327 - (42%)
Similarity:187/327 - (57%) Gaps:35/327 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ESNKYEKVAKIGQGTFGEVFKAREK-KGNKKFVAMKKVLMD-NEKEGFPITALREIRILQLLKHE 108
            :::.:||:.|||.||:..|:||::. .||  .||:|||..| ||:|.....| |||.||:.|.|.
plant   134 KADSFEKIDKIGSGTYSNVYKAKDSLTGN--IVALKKVRCDVNERESLKFMA-REILILRRLDHP 195

  Fly   109 NVVNLIEICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNVKFSLGEIKKVMQQLLNGLYYIH 173
            ||:.|      :...|:...|:.||||.:.:||||||.::..:||:..::|..|:|||:||.:.|
plant   196 NVIKL------EGLVTSRMSSSLYLVFRYMDHDLAGLAASPEIKFTEQQVKCYMKQLLSGLEHCH 254

  Fly   174 SNKILHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNY 238
            :..:||||:|.:|:||...|:|::.|||||..|...|   :...||||||||||.||||.|...|
plant   255 NRGVLHRDIKGSNLLIDDGGVLRIGDFGLATFFDASK---RQEMTNRVVTLWYRSPELLHGVVEY 316

  Fly   239 GPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQ 303
            ...||:|.||||:||:.....||.|..|.:||..|.:||||.:.:.|         |.|.||...
plant   317 SVGVDLWSAGCILAELLAGRAIMPGRNEVEQLHRIYKLCGSPSEEYW---------KKIRLPSTH 372

  Fly   304 KR-------RVKERLRPYVKD--QTGCDLLDKLLTLDPKKRIDADTALNHDFFWTDPM---PSDL 356
            |.       :.|.|:|...||  .....|||.||.|||.:|..|...|..|||.|:|:   ||||
plant   373 KHAHHKPLPQYKRRIREVYKDFSPEALSLLDTLLALDPAERQTATDVLMSDFFTTEPLACQPSDL 437

  Fly   357 SK 358
            .|
plant   438 PK 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 130/311 (42%)
AT3G05050NP_001326094.1 PKc_like 138..425 CDD:419665 130/307 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925637at2759
OrthoFinder 1 1.000 - - FOG0000444
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.